Search Antibody, Protein, and ELISA Kit Solutions

FANCG Antibody - C-terminal region (ARP76144_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP76144_P050-FITC Conjugated

ARP76144_P050-HRP Conjugated

ARP76144_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Protein Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-100740 from Santa Cruz Biotechnology.
Description of Target:
FANCG is a DNA repair protein that may operate in a postreplication repair or a cell cycle checkpoint function. It may be implicated in interstrand DNA cross-link repair and in the maintenance of normal chromosome stability. It is a candidate tumor suppressor gene.
Protein Size (# AA):
Molecular Weight:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FANCG.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FANCG.
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FANCG
Peptide Sequence:
Synthetic peptide located within the following region: AEHYLDLLALLLDSSEPRFSPPPSPPGPCMPEVFLEAAVALIQAGRAQDA
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-FANCG (ARP76144_P050) antibody is Catalog # AAP76144
Printable datasheet for anti-FANCG (ARP76144_P050) antibody
Target Reference:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...