Product Number |
ARP76144_P050-FITC |
Product Page |
www.avivasysbio.com/fancg-antibody-c-terminal-region-fitc-arp76144-p050-fitc.html |
Name |
FANCG Antibody - C-terminal region : FITC (ARP76144_P050-FITC) |
Protein Size (# AA) |
622 amino acids |
Molecular Weight |
68kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
2189 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
FAG, XRCC9 |
Peptide Sequence |
Synthetic peptide located within the following region: AEHYLDLLALLLDSSEPRFSPPPSPPGPCMPEVFLEAAVALIQAGRAQDA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Reference |
N/A |
Description of Target |
FANCG is a DNA repair protein that may operate in a postreplication repair or a cell cycle checkpoint function. It may be implicated in interstrand DNA cross-link repair and in the maintenance of normal chromosome stability. It is a candidate tumor suppressor gene. |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-FANCG (ARP76144_P050-FITC) antibody |
Blocking Peptide |
For anti-FANCG (ARP76144_P050-FITC) antibody is Catalog # AAP76144 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FANCG |
Uniprot ID |
O15287 |
Protein Accession # |
NP_004620 |
Purification |
Affinity purified |
Gene Symbol |
FANCG |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | |
|