FANCG Antibody - C-terminal region : FITC (ARP76144_P050-FITC)

Data Sheet
 
Product Number ARP76144_P050-FITC
Product Page www.avivasysbio.com/fancg-antibody-c-terminal-region-fitc-arp76144-p050-fitc.html
Name FANCG Antibody - C-terminal region : FITC (ARP76144_P050-FITC)
Protein Size (# AA) 622 amino acids
Molecular Weight 68kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 2189
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols FAG, XRCC9
Peptide Sequence Synthetic peptide located within the following region: AEHYLDLLALLLDSSEPRFSPPPSPPGPCMPEVFLEAAVALIQAGRAQDA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference N/A
Description of Target FANCG is a DNA repair protein that may operate in a postreplication repair or a cell cycle checkpoint function. It may be implicated in interstrand DNA cross-link repair and in the maintenance of normal chromosome stability. It is a candidate tumor suppressor gene.
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-FANCG (ARP76144_P050-FITC) antibody
Blocking Peptide For anti-FANCG (ARP76144_P050-FITC) antibody is Catalog # AAP76144
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human FANCG
Uniprot ID O15287
Protein Accession # NP_004620
Purification Affinity purified
Gene Symbol FANCG
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com