EXOC4 Antibody - N-terminal region (ARP56254_P050)

Catalog No: ARP56254_P050

WB Suggested Anti-EXOC4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EXOC4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: TAIRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKRDELRKLWIEGIE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-EXOC4 (ARP56254_P050) antibody is Catalog # AAP56254 (Previous Catalog # AAPP44472)

Target Info

• Gene Symbol: EXOC4
• Gene Full Name: Exocyst complex component 4
• Alias Symbols: SEC8, Sec8p, SEC8L1
• NCBI Gene Id: 60412
• Protein Name: Exocyst complex component 4
• Description of Target: The specific function of this protein remains unknown.
• Uniprot ID: Q96A65
• Protein Accession #: NP_001032203
• Nucleotide Accession #: NM_001037126
• Protein Size (# AA): 473
• Molecular Weight: 54kDa
• Protein Interactions: SUMO2; UBC; EXOC2; EXOC7; ATG5; ATG12; BECN1; EXOC8; EGFR; EXOC1; EXOC3; nef; IQCB1; EXOC5; UBD; MYO5A; DTNBP1; CEP63; DISC1; Poc1b; GTF2E2; DLGAP4; DLG3; RALA; GRIN2B; DLG4; MYC;