EXOC4 Antibody - N-terminal region (ARP56253_P050)

Catalog No: ARP56253_P050

WB Suggested Anti-EXOC4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

Host: Rabbit
Target Name: EXOC4
Sample Tissue: Human MCF7 Whole Cell
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EXOC4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
• Peptide Sequence: Synthetic peptide located within the following region: MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-EXOC4 (ARP56253_P050) antibody is Catalog # AAP56253 (Previous Catalog # AAPP38220)
• Reference: Pohl,C. (2008) Cell 132 (5), 832-845

Target Info

• Gene Symbol: EXOC4
• Gene Full Name: Exocyst complex component 4
• Alias Symbols: SEC8, Sec8p, SEC8L1
• NCBI Gene Id: 60412
• Protein Name: EXOC4 protein EMBL AAH26174.1
• Description of Target: The specific function of this protein remains unknown.The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Uniprot ID: Q8TAR2
• Protein Accession #: NP_001032203
• Nucleotide Accession #: NM_001037126
• Protein Size (# AA): 473
• Molecular Weight: 54kDa
• Protein Interactions: SUMO2; UBC; EXOC2; EXOC7; ATG5; ATG12; BECN1; EXOC8; EGFR; EXOC1; EXOC3; nef; IQCB1; EXOC5; UBD; MYO5A; DTNBP1; CEP63; DISC1; Poc1b; GTF2E2; DLGAP4; DLG3; RALA; GRIN2B; DLG4; MYC;