Catalog No: ARP56253_P050
Price: $0.00
SKU
ARP56253_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-EXOC4 (ARP56253_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human EXOC4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Peptide SequenceSynthetic peptide located within the following region: MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEA
Concentration0.5 mg/ml
Blocking PeptideFor anti-EXOC4 (ARP56253_P050) antibody is Catalog # AAP56253 (Previous Catalog # AAPP38220)
ReferencePohl,C. (2008) Cell 132 (5), 832-845
Gene SymbolEXOC4
Gene Full NameExocyst complex component 4
Alias SymbolsSEC8, Sec8p, SEC8L1
NCBI Gene Id60412
Protein NameEXOC4 protein EMBL AAH26174.1
Description of TargetThe specific function of this protein remains unknown.The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Uniprot IDQ8TAR2
Protein Accession #NP_001032203
Nucleotide Accession #NM_001037126
Protein Size (# AA)473
Molecular Weight54kDa
Protein InteractionsSUMO2; UBC; EXOC2; EXOC7; ATG5; ATG12; BECN1; EXOC8; EGFR; EXOC1; EXOC3; nef; IQCB1; EXOC5; UBD; MYO5A; DTNBP1; CEP63; DISC1; Poc1b; GTF2E2; DLGAP4; DLG3; RALA; GRIN2B; DLG4; MYC;
  1. What is the species homology for "EXOC4 Antibody - N-terminal region (ARP56253_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "EXOC4 Antibody - N-terminal region (ARP56253_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EXOC4 Antibody - N-terminal region (ARP56253_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "EXOC4 Antibody - N-terminal region (ARP56253_P050)"?

    This target may also be called "SEC8, Sec8p, SEC8L1" in publications.

  5. What is the shipping cost for "EXOC4 Antibody - N-terminal region (ARP56253_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EXOC4 Antibody - N-terminal region (ARP56253_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EXOC4 Antibody - N-terminal region (ARP56253_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "54kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EXOC4 Antibody - N-terminal region (ARP56253_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "EXOC4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EXOC4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EXOC4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EXOC4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EXOC4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EXOC4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EXOC4 Antibody - N-terminal region (ARP56253_P050)
Your Rating
We found other products you might like!