Search Antibody, Protein, and ELISA Kit Solutions

EIF2B5 Antibody - N-terminal region (ARP61329_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP61329_P050-FITC Conjugated

ARP61329_P050-HRP Conjugated

ARP61329_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa
NCBI Gene Id:
Protein Name:
Translation initiation factor eIF-2B subunit epsilon
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-111189 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), a GTP exchange factor for eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Mutations in this gene and the genes encoding other EIF2B subunits have been associated with leukoencephalopathy with vanishing white matter.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EIF2B5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EIF2B5.
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Dog: 92%; Horse: 85%; Human: 100%; Rat: 85%
Complete computational species homology data:
Anti-EIF2B5 (ARP61329_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPI
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-EIF2B5 (ARP61329_P050) antibody is Catalog # AAP61329 (Previous Catalog # AAPP47461)
Printable datasheet for anti-EIF2B5 (ARP61329_P050) antibody

Wortham, NC; Stewart, JD; Harris, S; Coldwell, MJ; Proud, CG; Stoichiometry of the eIF2B complex is maintained by mutual stabilization of subunits. 473, 571-80 (2016). WB, Cow, Dog, Horse, Human, Rat 26614765

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...