Catalog No: ARP61329_P050
Price: $0.00
SKU
ARP61329_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-EIF2B5 (ARP61329_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Cow, Dog, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 85%; Dog: 92%; Horse: 85%; Human: 100%; Rat: 85%
Peptide SequenceSynthetic peptide located within the following region: GVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPI
Concentration0.5 mg/ml
Blocking PeptideFor anti-EIF2B5 (ARP61329_P050) antibody is Catalog # AAP61329 (Previous Catalog # AAPP47461)
Subunitepsilon
Publications

Cellular eIF2B subunit localization: implications for the integrated stress response and its control by small molecule drugs. Mol Biol Cell. 30, 942-958 (2019). 30726166

Stoichiometry of the eIF2B complex is maintained by mutual stabilization of subunits. Biochem. J. 473, 571-80 (2016). 26614765

Gene SymbolEIF2B5
Gene Full NameEukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa
Alias SymbolsCLE, CACH, LVWM, EIF-2B, EIF2Bepsilon
NCBI Gene Id8893
Protein NameTranslation initiation factor eIF-2B subunit epsilon
Description of TargetThis gene encodes one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), a GTP exchange factor for eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Mutations in this gene and the genes encoding other EIF2B subunits have been associated with leukoencephalopathy with vanishing white matter.
Uniprot IDQ13144
Protein Accession #NP_003898
Nucleotide Accession #NM_003907
Protein Size (# AA)721
Molecular Weight80 kDa
Protein InteractionsUBC; EGFR; EIF2B2; EIF2B3; EIF2B4; APP; CHMP2A; GSK3A; GSK3B; EIF2S2; CSNK1A1; CSNK2A2; CSNK2A1; EIF2B1;
  1. What is the species homology for "EIF2B5 Antibody - N-terminal region (ARP61329_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Cow, Dog, Horse".

  2. How long will it take to receive "EIF2B5 Antibody - N-terminal region (ARP61329_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EIF2B5 Antibody - N-terminal region (ARP61329_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "EIF2B5 Antibody - N-terminal region (ARP61329_P050)"?

    This target may also be called "CLE, CACH, LVWM, EIF-2B, EIF2Bepsilon" in publications.

  5. What is the shipping cost for "EIF2B5 Antibody - N-terminal region (ARP61329_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EIF2B5 Antibody - N-terminal region (ARP61329_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EIF2B5 Antibody - N-terminal region (ARP61329_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "80 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EIF2B5 Antibody - N-terminal region (ARP61329_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "EIF2B5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EIF2B5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EIF2B5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EIF2B5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EIF2B5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EIF2B5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EIF2B5 Antibody - N-terminal region (ARP61329_P050)
Your Rating
We found other products you might like!