| Product Number |
ARP61329_P050 |
| Product Page |
www.avivasysbio.com/eif2b5-antibody-n-terminal-region-arp61329-p050.html |
| Name |
EIF2B5 Antibody - N-terminal region (ARP61329_P050) |
| Protein Size (# AA) |
721 amino acids |
| Molecular Weight |
80 kDa |
| Subunit |
epsilon |
| NCBI Gene Id |
8893 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa |
| Description |
|
| Alias Symbols |
CLE, CACH, LVWM, EIF-2B, EIF2Bepsilon |
| Peptide Sequence |
Synthetic peptide located within the following region: GVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), a GTP exchange factor for eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Mutations in this gene and the genes encoding other EIF2B subunits have been associated with leukoencephalopathy with vanishing white matter. |
| Protein Interactions |
UBC; EGFR; EIF2B2; EIF2B3; EIF2B4; APP; CHMP2A; GSK3A; GSK3B; EIF2S2; CSNK1A1; CSNK2A2; CSNK2A1; EIF2B1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-EIF2B5 (ARP61329_P050) antibody |
| Blocking Peptide |
For anti-EIF2B5 (ARP61329_P050) antibody is Catalog # AAP61329 (Previous Catalog # AAPP47461) |
| Uniprot ID |
Q13144 |
| Protein Name |
Translation initiation factor eIF-2B subunit epsilon |
| Publications |
Cellular eIF2B subunit localization: implications for the integrated stress response and its control by small molecule drugs. Mol Biol Cell. 30, 942-958 (2019). 30726166
Stoichiometry of the eIF2B complex is maintained by mutual stabilization of subunits. Biochem. J. 473, 571-80 (2016). 26614765 |
| Protein Accession # |
NP_003898 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003907 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
EIF2B5 |
| Predicted Species Reactivity |
Human, Rat, Cow, Dog, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 92%; Horse: 85%; Human: 100%; Rat: 85% |
| Image 1 |
 | 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.
|
|
