| Sku |
AAP61329 |
| Old sku |
AAPP47461 |
| Price |
$99.00 |
| Name |
EIF2B5 Peptide - N-terminal region (AAP61329) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
EIF2B5 |
| Alias symbols |
CACH, CLE, EIF-2B, EIF2Bepsilon, LVWM |
| Gene id |
8893 |
| Description of target |
This gene encodes one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), a GTP exchange factor for eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Mutations in this gene and the genes encoding other EIF2B subunits have been associated with leukoencephalopathy with vanishing white matter. |
| Swissprot id |
Q13144 |
| Protein accession num |
NP_003898 |
| Nucleotide accession num |
NM_003907 |
| Protein size |
721 amino acids |
| Molecular weight |
79kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
GVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPI |
| Partner proteins |
CHMP2A,CSNK1A1,CSNK2A1,CSNK2A2,EIF2B2,EIF2S2,GSK3A,GSK3B,EIF2B1,EIF2B2,EIF2B3,EIF2B4 |
| Subunit |
epsilon |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-EIF2B5 Antibody (ARP61329_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
