Sku |
AAP61329 |
Old sku |
AAPP47461 |
Price |
$99.00 |
Name |
EIF2B5 Peptide - N-terminal region (AAP61329) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
EIF2B5 |
Alias symbols |
CACH, CLE, EIF-2B, EIF2Bepsilon, LVWM |
Gene id |
8893 |
Description of target |
This gene encodes one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), a GTP exchange factor for eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Mutations in this gene and the genes encoding other EIF2B subunits have been associated with leukoencephalopathy with vanishing white matter. |
Swissprot id |
Q13144 |
Protein accession num |
NP_003898 |
Nucleotide accession num |
NM_003907 |
Protein size |
721 amino acids |
Molecular weight |
79kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
GVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPI |
Partner proteins |
CHMP2A,CSNK1A1,CSNK2A1,CSNK2A2,EIF2B2,EIF2S2,GSK3A,GSK3B,EIF2B1,EIF2B2,EIF2B3,EIF2B4 |
Subunit |
epsilon |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-EIF2B5 Antibody (ARP61329_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |