Search Antibody, Protein, and ELISA Kit Solutions

EFNA2 Antibody - middle region (ARP61345_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP61345_P050-FITC Conjugated

ARP61345_P050-HRP Conjugated

ARP61345_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-33163 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the ephrin family. The protein is composed of a signal sequence, a receptor-binding region, a spacer region, and a hydrophobic region. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. Posttranslational modifications determine whether this protein localizes to the nucleus or the cytoplasm.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EFNA2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EFNA2.
Predicted Species Reactivity:
Cow, Guinea Pig, Human, Mouse, Rat
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-EFNA2 (ARP61345_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-EFNA2 (ARP61345_P050) antibody is Catalog # AAP61345 (Previous Catalog # AAPP48210)
Printable datasheet for anti-EFNA2 (ARP61345_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...