| Product Number |
ARP61345_P050 |
| Product Page |
www.avivasysbio.com/efna2-antibody-middle-region-arp61345-p050.html |
| Name |
EFNA2 Antibody - middle region (ARP61345_P050) |
| Protein Size (# AA) |
213 amino acids |
| Molecular Weight |
23kDa |
| NCBI Gene Id |
1943 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Ephrin-A2 |
| Alias Symbols |
ELF-1, EPLG6, LERK6, HEK7-L, LERK-6 |
| Peptide Sequence |
Synthetic peptide located within the following region: YGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a member of the ephrin family. The protein is composed of a signal sequence, a receptor-binding region, a spacer region, and a hydrophobic region. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. Posttranslational modifications determine whether this protein localizes to the nucleus or the cytoplasm. |
| Protein Interactions |
BAP1; ADAM10; EPHA5; EPHA3; EPHA2; RUNX1; EPHA7; ZHX1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-EFNA2 (ARP61345_P050) antibody |
| Blocking Peptide |
For anti-EFNA2 (ARP61345_P050) antibody is Catalog # AAP61345 (Previous Catalog # AAPP48210) |
| Uniprot ID |
O43921 |
| Protein Name |
Ephrin-A2 |
| Protein Accession # |
NP_001396 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001405 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
EFNA2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
| Image 1 | Human Placenta
 | WB Suggested Anti-EFNA2 Antibody
Titration: 1.0 ug/ml
Positive Control: Placenta |
| | Image 2 | Mouse Pancreas
 | Host: Mouse
Target Name: EFNA2
Sample Tissue: Mouse Pancreas
Antibody Dilution: 1ug/ml |
|
|
