| Sku |
AAP61345 |
| Old sku |
AAPP48210 |
| Price |
$99.00 |
| Name |
EFNA2 Peptide - middle region (AAP61345) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
EFNA2 |
| Alias symbols |
ELF-1, EPLG6, HEK7-L, LERK6, LERK-6 |
| Gene id |
1943 |
| Description of target |
This gene encodes a member of the ephrin family. The protein is composed of a signal sequence, a receptor-binding region, a spacer region, and a hydrophobic region. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. Posttranslational modifications determine whether this protein localizes to the nucleus or the cytoplasm. |
| Swissprot id |
O43921 |
| Protein accession num |
NP_001396 |
| Nucleotide accession num |
NM_001405 |
| Protein size |
213 amino acids |
| Molecular weight |
23kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
YGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLK |
| Partner proteins |
ADAM10,EPHA2,EPHA3,EPHA5,ADAM10,EPHA7,RUNX1,ZHX1 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-EFNA2 Antibody (ARP61345_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
