Catalog No: ARP43560_T100
Price: $0.00
SKU
ARP43560_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ECH1 (ARP43560_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ECH1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 92%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: PDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDA
Concentration1.0 mg/ml
Blocking PeptideFor anti-ECH1 (ARP43560_T100) antibody is Catalog # AAP43560 (Previous Catalog # AAPP25005)
Sample Type Confirmation

ECH1 is supported by BioGPS gene expression data to be expressed in HepG2

ReferenceGoehler,H., (2004) Mol. Cell 15 (6), 853-865
Publications

Xie, W., Zhang, S., Lei, F., Ouyang, X. & Du, L. Ananas comosus L. Leaf Phenols and p-Coumaric Acid Regulate Liver Fat Metabolism by Upregulating CPT-1 Expression. Evid. Based. Complement. Alternat. Med. 2014, 903258 (2014). 25197313

Xie, W.-D. et al. Enhanced peroxisomal beta-oxidation metabolism in visceral adipose tissues of high-fat diet-fed obesity-resistant C57BL/6 mice. Exp. Ther. Med. 2, 309-315 (2011). 22977503

Gene SymbolECH1
Gene Full NameEnoyl CoA hydratase 1, peroxisomal
Alias SymbolsHPXEL
NCBI Gene Id1891
Protein NameDelta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
Description of TargetECH1 is a member of the hydratase/isomerase superfamily. ECH1 shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The protein contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway.This gene encodes a member of the hydratase/isomerase superfamily. The gene product shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The encoded protein, which contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. The rat ortholog, which localizes to the matrix of both the peroxisome and mitochondria, can isomerize 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway. Expression of the rat gene is induced by peroxisome proliferators.
Uniprot IDQ13011
Protein Accession #NP_001389
Nucleotide Accession #NM_001398
Protein Size (# AA)328
Molecular Weight36kDa
Protein InteractionsFAM9B; HUWE1; TRAF1; UBC; MDM2; PPP6R3; IQCB1; STAT3; PEX5; EEF1D; DNAJB11; HNRNPUL1; OPA1; APP; HTT; EEF1G; HDAC5; ICT1; TLR10; PAFAH1B3; SERPINB9; CSTF2; TIMP1;
  1. What is the species homology for "ECH1 Antibody - N-terminal region (ARP43560_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit".

  2. How long will it take to receive "ECH1 Antibody - N-terminal region (ARP43560_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ECH1 Antibody - N-terminal region (ARP43560_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ECH1 Antibody - N-terminal region (ARP43560_T100)"?

    This target may also be called "HPXEL" in publications.

  5. What is the shipping cost for "ECH1 Antibody - N-terminal region (ARP43560_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ECH1 Antibody - N-terminal region (ARP43560_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ECH1 Antibody - N-terminal region (ARP43560_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "36kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ECH1 Antibody - N-terminal region (ARP43560_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ECH1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ECH1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ECH1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ECH1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ECH1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ECH1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ECH1 Antibody - N-terminal region (ARP43560_T100)
Your Rating
We found other products you might like!