Search Antibody, Protein, and ELISA Kit Solutions

ECH1 Antibody - N-terminal region (ARP43560_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43560_T100-FITC Conjugated

ARP43560_T100-HRP Conjugated

ARP43560_T100-Biotin Conjugated

Gene Symbol:
ECH1
Official Gene Full Name:
Enoyl CoA hydratase 1, peroxisomal
NCBI Gene Id:
1891
Protein Name:
Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
Swissprot Id:
Q13011
Protein Accession #:
NP_001389
Nucleotide Accession #:
NM_001398
Alias Symbols:
HPXEL
Replacement Item:
This antibody may replace item sc-133532 from Santa Cruz Biotechnology.
Description of Target:
ECH1 is a member of the hydratase/isomerase superfamily. ECH1 shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The protein contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway.This gene encodes a member of the hydratase/isomerase superfamily. The gene product shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The encoded protein, which contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. The rat ortholog, which localizes to the matrix of both the peroxisome and mitochondria, can isomerize 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway. Expression of the rat gene is induced by peroxisome proliferators.
Protein Size (# AA):
328
Molecular Weight:
36kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ECH1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ECH1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ECH1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Complete computational species homology data:
Anti-ECH1 (ARP43560_T100)
Peptide Sequence:
Synthetic peptide located within the following region: PDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
FAM9B; HUWE1; TRAF1; UBC; MDM2; PPP6R3; IQCB1; STAT3; PEX5; EEF1D; DNAJB11; HNRNPUL1; OPA1; APP; HTT; EEF1G; HDAC5; ICT1; TLR10; PAFAH1B3; SERPINB9; CSTF2; TIMP1;
Blocking Peptide:
For anti-ECH1 (ARP43560_T100) antibody is Catalog # AAP43560 (Previous Catalog # AAPP25005)
Datasheets/Manuals:
Printable datasheet for anti-ECH1 (ARP43560_T100) antibody
Sample Type Confirmation:

ECH1 is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Goehler,H., (2004) Mol. Cell 15 (6), 853-865
Publications:

Xie, W., Zhang, S., Lei, F., Ouyang, X. & Du, L. Ananas comosus L. Leaf Phenols and p-Coumaric Acid Regulate Liver Fat Metabolism by Upregulating CPT-1 Expression. Evid. Based. Complement. Alternat. Med. 2014, 903258 (2014). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat 25197313

Xie, W.-D. et al. Enhanced peroxisomal b-oxidation metabolism in visceral adipose tissues of high-fat diet-fed obesity-resistant C57BL/6 mice. Exp. Ther. Med. 2, 309-315 (2011). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat 22977503

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...