Size:100 ul
$229.00
In Stock
SKU
ARP43560_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43560_T100-FITC Conjugated

ARP43560_T100-HRP Conjugated

ARP43560_T100-Biotin Conjugated

ECH1 Antibody - N-terminal region (ARP43560_T100)

Catalog#: ARP43560_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-133532 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ECH1
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 92%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Complete computational species homology data Anti-ECH1 (ARP43560_T100)
Peptide Sequence Synthetic peptide located within the following region: PDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ECH1 (ARP43560_T100) antibody is Catalog # AAP43560 (Previous Catalog # AAPP25005)
Datasheets/Manuals Printable datasheet for anti-ECH1 (ARP43560_T100) antibody
Sample Type Confirmation

ECH1 is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference Goehler,H., (2004) Mol. Cell 15 (6), 853-865
Publications

Xie, W., Zhang, S., Lei, F., Ouyang, X. & Du, L. Ananas comosus L. Leaf Phenols and p-Coumaric Acid Regulate Liver Fat Metabolism by Upregulating CPT-1 Expression. Evid. Based. Complement. Alternat. Med. 2014, 903258 (2014). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat 25197313

Xie, W.-D. et al. Enhanced peroxisomal b-oxidation metabolism in visceral adipose tissues of high-fat diet-fed obesity-resistant C57BL/6 mice. Exp. Ther. Med. 2, 309-315 (2011). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat 22977503

Gene Symbol ECH1
Official Gene Full Name Enoyl CoA hydratase 1, peroxisomal
Alias Symbols HPXEL
NCBI Gene Id 1891
Protein Name Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
Description of Target ECH1 is a member of the hydratase/isomerase superfamily. ECH1 shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The protein contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway.This gene encodes a member of the hydratase/isomerase superfamily. The gene product shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The encoded protein, which contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. The rat ortholog, which localizes to the matrix of both the peroxisome and mitochondria, can isomerize 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway. Expression of the rat gene is induced by peroxisome proliferators.
Swissprot Id Q13011
Protein Accession # NP_001389
Nucleotide Accession # NM_001398
Protein Size (# AA) 328
Molecular Weight 36kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ECH1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ECH1.
Protein Interactions FAM9B; HUWE1; TRAF1; UBC; MDM2; PPP6R3; IQCB1; STAT3; PEX5; EEF1D; DNAJB11; HNRNPUL1; OPA1; APP; HTT; EEF1G; HDAC5; ICT1; TLR10; PAFAH1B3; SERPINB9; CSTF2; TIMP1;
  1. What is the species homology for "ECH1 Antibody - N-terminal region (ARP43560_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "ECH1 Antibody - N-terminal region (ARP43560_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ECH1 Antibody - N-terminal region (ARP43560_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ECH1 Antibody - N-terminal region (ARP43560_T100)"?

    This target may also be called "HPXEL" in publications.

  5. What is the shipping cost for "ECH1 Antibody - N-terminal region (ARP43560_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ECH1 Antibody - N-terminal region (ARP43560_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ECH1 Antibody - N-terminal region (ARP43560_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "36kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ECH1 Antibody - N-terminal region (ARP43560_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ECH1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ECH1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ECH1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ECH1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ECH1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ECH1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ECH1 Antibody - N-terminal region (ARP43560_T100)
Your Rating
We found other products you might like!