DLK1 Recombinant Protein (Human) (OPCA03844)

Catalog No: OPCA03844

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Homo sapiens (Human)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
• Protein Sequence: AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 24-303 aa
• Tag: N-terminal 6xHis-tagged
• Reference: Human urinary glycoproteomics; attachment site specific analysis of N-and O-linked glycosylations by CID and ECD.Halim A., Nilsson J., Ruetschi U., Hesse C., Larson G.Mol. Cell. Proteomics 0:0-0(2011)

Target Info

• Gene Symbol: DLK1
• Gene Full Name: delta like non-canonical Notch ligand 1
• Alias Symbols: Delta1;delta-like 1 homolog;DLK;DLK-1;FA1;fetal antigen 1;pG2;preadipocyte factor 1;Pref-1;PREF1;protein delta homolog 1;secredeltin;ZOG.
• NCBI Gene Id: 8788
• Protein Name: Protein delta homolog 1
• Description of Target: May have a role in neuroendocrine differentiation.
• Uniprot ID: P80370
• Protein Accession #: NP_001304101
• Nucleotide Accession #: NM_001317172
• Protein Size (# AA): Recombinant
• Molecular Weight: 33.8 kDa