Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP46375_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP46375_P050-FITC Conjugated

ARP46375_P050-HRP Conjugated

ARP46375_P050-Biotin Conjugated

DLK1 Antibody - middle region (ARP46375_P050)

Catalog#: ARP46375_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-25437 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DLK1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rat: 100%; Sheep: 93%
Complete computational species homology data Anti-DLK1 (ARP46375_P050)
Peptide Sequence Synthetic peptide located within the following region: SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-DLK1 (ARP46375_P050) antibody is Catalog # AAP46375 (Previous Catalog # AAPP27159)
Datasheets/Manuals Printable datasheet for anti-DLK1 (ARP46375_P050) antibody
Target Reference Wermter,A.K., (er) Eur. J. Hum. Genet. (2008) In press
Publications

Zhou, G. et al. Global comparison of gene expression profiles between intramuscular and subcutaneous adipocytes of neonatal landrace pig using microarray. Meat Sci. 86, 440-50 (2010). WB, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep 20573458

Gene Symbol DLK1
Official Gene Full Name Delta-like 1 homolog (Drosophila)
Alias Symbols DLK, FA1, PREF1, Pref-1, ZOG, pG2, Delta1
NCBI Gene Id 8788
Protein Name Protein delta homolog 1
Description of Target DLK1 may have a role in neuroendocrine differentiation.
Swissprot Id P80370
Protein Accession # NP_003827
Nucleotide Accession # NM_003836
Protein Size (# AA) 383
Molecular Weight 41kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DLK1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DLK1.
Protein Interactions GAS1; GRN;
  1. What is the species homology for "DLK1 Antibody - middle region (ARP46375_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep".

  2. How long will it take to receive "DLK1 Antibody - middle region (ARP46375_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DLK1 Antibody - middle region (ARP46375_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DLK1 Antibody - middle region (ARP46375_P050)"?

    This target may also be called "DLK, FA1, PREF1, Pref-1, ZOG, pG2, Delta1" in publications.

  5. What is the shipping cost for "DLK1 Antibody - middle region (ARP46375_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DLK1 Antibody - middle region (ARP46375_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DLK1 Antibody - middle region (ARP46375_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DLK1 Antibody - middle region (ARP46375_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "DLK1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DLK1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DLK1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DLK1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DLK1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DLK1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DLK1 Antibody - middle region (ARP46375_P050)
Your Rating
We found other products you might like!