Search Antibody, Protein, and ELISA Kit Solutions

DLK1 Antibody - middle region (ARP46375_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP46375_P050-FITC Conjugated

ARP46375_P050-HRP Conjugated

ARP46375_P050-Biotin Conjugated

Gene Symbol:
DLK1
Official Gene Full Name:
Delta-like 1 homolog (Drosophila)
NCBI Gene Id:
8788
Protein Name:
Protein delta homolog 1
Swissprot Id:
P80370
Protein Accession #:
NP_003827
Nucleotide Accession #:
NM_003836
Alias Symbols:
DLK, FA1, PREF1, Pref-1, ZOG, pG2, Delta1
Replacement Item:
This antibody may replace item sc-25437 from Santa Cruz Biotechnology.
Description of Target:
DLK1 may have a role in neuroendocrine differentiation.
Protein Size (# AA):
383
Molecular Weight:
41kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DLK1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DLK1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human DLK1
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rat: 100%; Sheep: 93%
Complete computational species homology data:
Anti-DLK1 (ARP46375_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
GAS1; GRN;
Blocking Peptide:
For anti-DLK1 (ARP46375_P050) antibody is Catalog # AAP46375 (Previous Catalog # AAPP27159)
Datasheets/Manuals:
Printable datasheet for anti-DLK1 (ARP46375_P050) antibody
Target Reference:
Wermter,A.K., (er) Eur. J. Hum. Genet. (2008) In press
Publications:

Zhou, G. et al. Global comparison of gene expression profiles between intramuscular and subcutaneous adipocytes of neonatal landrace pig using microarray. Meat Sci. 86, 440-50 (2010). WB, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep 20573458

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...