Now Offering Over 102,157 Antibodies & 44,722 Antigens!

DHX30 antibody - N-terminal region (ARP36525_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$319.00
In Stock

Conjugation Options

ARP36525_P050-FITC Conjugated

ARP36525_P050-HRP Conjugated

ARP36525_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
DHX30
NCBI Gene Id:
22907
Official Gene Full Name:
DEAH (Asp-Glu-Ala-His) box polypeptide 30
Protein Name:
Putative ATP-dependent RNA helicase DHX30
Swissprot Id:
Q7L2E3-2
Protein Accession #:
NP_619519
Nucleotide Accession #:
NM_138614
Alias Symbols:
DDX30, FLJ11214, KIAA0890, RETCOR
Description of Target:
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX30 is a member of this family.DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The encoded protein has 97% sequence identity with the mouse HELG protein. Alternative splicing of this gene generates 3 transcript variants.
Protein Size (# AA):
361
Molecular Weight:
40kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DHX30.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DHX30.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human DHX30
Species Reactivity:
Cow, Dog, Human, Mouse, Pig, Rabbit
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%
Complete computational species homology data:
Anti-DHX30 (ARP36525_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AESGMAPGGPGEGDGSLVNASRDLLKEFPQPKNLLNSVIGRALGISHAKD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SUMO2; SUMO3; IVNS1ABP; STAU1; GRSF1; UBC; SUMO1; NEDD8; Fbxl16; WWOX; SUZ12; RNF2; EZH2; NEDD4; TARDBP; HNRNPD; EIF2AK2; SKIL; FN1; ESR1; NDUFA2; ILF3; GNAI2; RAB31; GRK5; CAND1; COPS5; CUL1; CUL3; CUL4B; CUL5; SIRT7; HNRNPA1; HDGF; DHX58; OAS3; Sgol2; Y
Blocking Peptide:
For anti-DHX30 (ARP36525_P050) antibody is Catalog # AAP36525 (Previous Catalog # AAPS07208)
Datasheets/Manuals:
Printable datasheet for anti-DHX30 (ARP36525_P050) antibody
Sample Type Confirmation:

DHX30 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Tell us what you think about this item!

Write A Review
    Please, wait...