Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

CTCF Antibody - N-terminal region (P100757_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

P100757_P050-FITC Conjugated

P100757_P050-HRP Conjugated

P100757_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
CCCTC-binding factor (zinc finger protein)
NCBI Gene Id:
Protein Name:
Transcriptional repressor CTCF
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Replacement Item:
This antibody may replace item sc-119494 from Santa Cruz Biotechnology.
Description of Target:
CTCF is a transcriptional regulator protein with 11 highly conserved zinc finger (ZF) domains. This nuclear protein is able to use different combinations of the ZF domains to bind different DNA target sequences and proteins. Depending upon the context of the site, the protein can bind a histone acetyltransferase (HAT)-containing complex and function as a transcriptional activator or bind a histone deacetylase (HDAC)-containing complex and function as a transcriptional repressor. If the protein is bound to a transcriptional insulator element, it can block communication between enhancers and upstream promoters, thereby regulating imprinted expression. Mutations in CTCF have been associated with invasive breast cancers, prostate cancers, and Wilms' tumors.This gene is a member of the BORIS + CTCF gene family and encodes a transcriptional regulator protein with 11 highly conserved zinc finger (ZF) domains. This nuclear protein is able to use different combinations of the ZF domains to bind different DNA target sequences and proteins. Depending upon the context of the site, the protein can bind a histone acetyltransferase (HAT)-containing complex and function as a transcriptional activator or bind a histone deacetylase (HDAC)-containing complex and function as a transcriptional repressor. If the protein is bound to a transcriptional insulator element, it can block communication between enhancers and upstream promoters, thereby regulating imprinted expression. Mutations in this gene have been associated with invasive breast cancers, prostate cancers, and Wilms' tumors.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CTCF.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CTCF.
The immunogen is a synthetic peptide directed towards the N terminal region of human CTCF
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-CTCF (P100757_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CTCF (P100757_P050) antibody is Catalog # AAP31079 (Previous Catalog # AAPP01818)
Printable datasheet for anti-CTCF (P100757_P050) antibody
Target Reference:
Defossez,P.A., (2005) J. Biol. Chem. 280 (52), 43017-43023

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...