Search Antibody, Protein, and ELISA Kit Solutions

CTCF Antibody - N-terminal region (ARP38820_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38820_P050-FITC Conjugated

ARP38820_P050-HRP Conjugated

ARP38820_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
CHIP, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
CTCF
Official Gene Full Name:
CCCTC-binding factor (zinc finger protein)
NCBI Gene Id:
10664
Protein Name:
Transcriptional repressor CTCF
Swissprot Id:
P49711
Protein Accession #:
NP_006556
Nucleotide Accession #:
NM_006565
Replacement Item:
This antibody may replace item sc-119494 from Santa Cruz Biotechnology.
Description of Target:
CTCF is a transcriptional regulator protein with 11 highly conserved zinc finger (ZF) domains. This nuclear protein is able to use different combinations of the ZF domains to bind different DNA target sequences and proteins. Depending upon the context of the site, the protein can bind a histone acetyltransferase (HAT)-containing complex and function as a transcriptional activator or bind a histone deacetylase (HDAC)-containing complex and function as a transcriptional repressor. If the protein is bound to a transcriptional insulator element, it can block communication between enhancers and upstream promoters, thereby regulating imprinted expression. Mutations in CTCF have been associated with invasive breast cancers, prostate cancers, and Wilms' tumors.This gene is a member of the BORIS + CTCF gene family and encodes a transcriptional regulator protein with 11 highly conserved zinc finger (ZF) domains. This nuclear protein is able to use different combinations of the ZF domains to bind different DNA target sequences and proteins. Depending upon the context of the site, the protein can bind a histone acetyltransferase (HAT)-containing complex and function as a transcriptional activator or bind a histone deacetylase (HDAC)-containing complex and function as a transcriptional repressor. If the protein is bound to a transcriptional insulator element, it can block communication between enhancers and upstream promoters, thereby regulating imprinted expression. Mutations in this gene have been associated with invasive breast cancers, prostate cancers, and Wilms' tumors.
Protein Size (# AA):
727
Molecular Weight:
83kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CTCF.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CTCF.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CTCF
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-CTCF (ARP38820_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEV
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ZMYM4; UBC; EED; BMI1; KANSL1; CDK19; ZMYM2; CAND1; ZBTB33; TFAP4; SUMO1; SUMO2; SUMO3; SIRT7; TAF3; SMC3; POLR2A; SUZ12; Ctcf; HIST2H2AC; TOP2A; TAF1; NPM1; LMNA; KPNA4; KPNA2; H2AFZ; PARP1; TRB; RXRA; SMAD3; SIN3A; SMC1A; RAD21; YY1; THRB; SMAD4; HMGB1;
Blocking Peptide:
For anti-CTCF (ARP38820_P050) antibody is Catalog # AAP38820 (Previous Catalog # AAPP21028)
Datasheets/Manuals:
Printable datasheet for anti-CTCF (ARP38820_P050) antibody
Target Reference:
Defossez,P.A., (2005) J. Biol. Chem. 280 (52), 43017-43023

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...