Catalog No: ARP38820_P050
Price: $0.00
SKU
ARP38820_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CTCF (ARP38820_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationCHIP, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CTCF
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEV
Concentration0.5 mg/ml
Blocking PeptideFor anti-CTCF (ARP38820_P050) antibody is Catalog # AAP38820 (Previous Catalog # AAPP21028)
ReferenceDefossez,P.A., (2005) J. Biol. Chem. 280 (52), 43017-43023
Publications

Folding Keratin Gene Clusters during Skin Regional Specification. Dev Cell. 53, 561-576.e9 (2020) 32516596

Description
Gene SymbolCTCF
Gene Full NameCCCTC-binding factor (zinc finger protein)
Alias SymbolsMRD21, FAP108, CFAP108
NCBI Gene Id10664
Protein NameTranscriptional repressor CTCF
Description of TargetCTCF is a transcriptional regulator protein with 11 highly conserved zinc finger (ZF) domains. This nuclear protein is able to use different combinations of the ZF domains to bind different DNA target sequences and proteins. Depending upon the context of the site, the protein can bind a histone acetyltransferase (HAT)-containing complex and function as a transcriptional activator or bind a histone deacetylase (HDAC)-containing complex and function as a transcriptional repressor. If the protein is bound to a transcriptional insulator element, it can block communication between enhancers and upstream promoters, thereby regulating imprinted expression. Mutations in CTCF have been associated with invasive breast cancers, prostate cancers, and Wilms' tumors.This gene is a member of the BORIS + CTCF gene family and encodes a transcriptional regulator protein with 11 highly conserved zinc finger (ZF) domains. This nuclear protein is able to use different combinations of the ZF domains to bind different DNA target sequences and proteins. Depending upon the context of the site, the protein can bind a histone acetyltransferase (HAT)-containing complex and function as a transcriptional activator or bind a histone deacetylase (HDAC)-containing complex and function as a transcriptional repressor. If the protein is bound to a transcriptional insulator element, it can block communication between enhancers and upstream promoters, thereby regulating imprinted expression. Mutations in this gene have been associated with invasive breast cancers, prostate cancers, and Wilms' tumors.
Uniprot IDP49711
Protein Accession #NP_006556
Nucleotide Accession #NM_006565
Protein Size (# AA)727
Molecular Weight83kDa
Protein InteractionsZMYM4; UBC; EED; BMI1; KANSL1; CDK19; ZMYM2; CAND1; ZBTB33; TFAP4; SUMO1; SUMO2; SUMO3; SIRT7; TAF3; SMC3; POLR2A; SUZ12; Ctcf; HIST2H2AC; TOP2A; TAF1; NPM1; LMNA; KPNA4; KPNA2; H2AFZ; PARP1; TRB; RXRA; SMAD3; SIN3A; SMC1A; RAD21; YY1; THRB; SMAD4; HMGB1;
  1. What is the species homology for "CTCF Antibody - N-terminal region (ARP38820_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "CTCF Antibody - N-terminal region (ARP38820_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CTCF Antibody - N-terminal region (ARP38820_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CTCF Antibody - N-terminal region (ARP38820_P050)"?

    This target may also be called "MRD21, FAP108, CFAP108" in publications.

  5. What is the shipping cost for "CTCF Antibody - N-terminal region (ARP38820_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CTCF Antibody - N-terminal region (ARP38820_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CTCF Antibody - N-terminal region (ARP38820_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "83kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CTCF Antibody - N-terminal region (ARP38820_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CTCF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CTCF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CTCF"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CTCF"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CTCF"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CTCF"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CTCF Antibody - N-terminal region (ARP38820_P050)
Your Rating