Search Antibody, Protein, and ELISA Kit Solutions

CRY1 Antibody - N-terminal region (ARP59758_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP59758_P050-FITC Conjugated

ARP59758_P050-HRP Conjugated

ARP59758_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
CRY1
Official Gene Full Name:
Cryptochrome 1 (photolyase-like)
NCBI Gene Id:
1407
Protein Name:
Cryptochrome-1
Swissprot Id:
Q16526
Protein Accession #:
NP_004066
Nucleotide Accession #:
NM_004075
Alias Symbols:
PHLL1
Replacement Item:
This antibody may replace item sc-101006 from Santa Cruz Biotechnology.
Description of Target:
CRY1 is the blue light-dependent regulator of the circadian feedback loop. CRY1 inhibits CLOCK NPAS2-ARNTL E box-mediated transcription. CRY1 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. CRY1 has no photolyase activity. CRY1 is capable of translocating circadian clock core proteins such as PER proteins to the nucleus. CRY1 may inhibit CLOCK NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.
Protein Size (# AA):
586
Molecular Weight:
64kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CRY1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CRY1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CRY1
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-CRY1 (ARP59758_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PER2; FBXL3; FBXL21; PLSCR1; BTRC; CUL1; SKP1; CSNK1E; LTBP4; UBC; SNRPD3; GRN; USP2; Timeless; Cry1; KRTAP4-12; PER3; MDFI; CBLB; ARNTL; PER1; TRAF2;
Blocking Peptide:
For anti-CRY1 (ARP59758_P050) antibody is Catalog # AAPP45928
Datasheets/Manuals:
Printable datasheet for anti-CRY1 (ARP59758_P050) antibody
Publications:

Currie, SP; Doherty, GH; Sillar, KT; Deep-brain photoreception links luminance detection to motor output in Xenopus frog tadpoles. 113, 6053-8 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 27166423

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...