Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP59758_P050-FITC Conjugated

ARP59758_P050-HRP Conjugated

ARP59758_P050-Biotin Conjugated

CRY1 Antibody - N-terminal region (ARP59758_P050)

Catalog#: ARP59758_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-101006 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CRY1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Complete computational species homology data Anti-CRY1 (ARP59758_P050)
Peptide Sequence Synthetic peptide located within the following region: KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CRY1 (ARP59758_P050) antibody is Catalog # AAPP45928
Datasheets/Manuals Printable datasheet for anti-CRY1 (ARP59758_P050) antibody

Currie, SP; Doherty, GH; Sillar, KT; Deep-brain photoreception links luminance detection to motor output in Xenopus frog tadpoles. 113, 6053-8 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 27166423

Gene Symbol CRY1
Official Gene Full Name Cryptochrome 1 (photolyase-like)
Alias Symbols PHLL1
NCBI Gene Id 1407
Protein Name Cryptochrome-1
Description of Target CRY1 is the blue light-dependent regulator of the circadian feedback loop. CRY1 inhibits CLOCK NPAS2-ARNTL E box-mediated transcription. CRY1 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. CRY1 has no photolyase activity. CRY1 is capable of translocating circadian clock core proteins such as PER proteins to the nucleus. CRY1 may inhibit CLOCK NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.
Swissprot Id Q16526
Protein Accession # NP_004066
Nucleotide Accession # NM_004075
Protein Size (# AA) 586
Molecular Weight 64kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CRY1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CRY1.
Protein Interactions PER2; FBXL3; FBXL21; PLSCR1; BTRC; CUL1; SKP1; CSNK1E; LTBP4; UBC; SNRPD3; GRN; USP2; Timeless; Cry1; KRTAP4-12; PER3; MDFI; CBLB; ARNTL; PER1; TRAF2;
  1. What is the species homology for "CRY1 Antibody - N-terminal region (ARP59758_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish".

  2. How long will it take to receive "CRY1 Antibody - N-terminal region (ARP59758_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CRY1 Antibody - N-terminal region (ARP59758_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "CRY1 Antibody - N-terminal region (ARP59758_P050)"?

    This target may also be called "PHLL1" in publications.

  5. What is the shipping cost for "CRY1 Antibody - N-terminal region (ARP59758_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CRY1 Antibody - N-terminal region (ARP59758_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CRY1 Antibody - N-terminal region (ARP59758_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "64kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CRY1 Antibody - N-terminal region (ARP59758_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CRY1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CRY1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CRY1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CRY1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CRY1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CRY1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CRY1 Antibody - N-terminal region (ARP59758_P050)
Your Rating
We found other products you might like!