| Sku |
AAPP45928 |
| Price |
$99.00 |
| Name |
CRY1 Peptide - N-terminal region (AAPP45928) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
CRY1 |
| Alias symbols |
PHLL1 |
| Gene id |
1407 |
| Description of target |
CRY1 is the blue light-dependent regulator of the circadian feedback loop. 'CRY1 inhibits CLOCK|NPAS2-ARNTL E box-mediated transcription.'CRY1 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. 'CRY1 has no photolyase activity. 'CRY1 is capable of translocating circadian clock core proteins such as PER proteins to the nucleus. 'CRY1 may inhibit CLOCK|NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL. |
| Swissprot id |
Q16526 |
| Protein accession num |
NP_004066 |
| Nucleotide accession num |
NM_004075 |
| Protein size |
586 amino acids |
| Molecular weight |
64kDa |
| Species reactivity |
Human |
| Application |
IHC, WB |
| Peptide sequence |
KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF |
| Partner proteins |
ARNTL,CBLB,CSNK1E,KRTAP4-12,MDFI,PER1,PER2,PER3,PLSCR1,TIMELESS,TRAF2,ARNTL,CBLB,CRY1,KRTAP4-12,MDFI,PER1,PER2,PLSCR1,TRAF2 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-CRY1 Antibody(ARP59758_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
