CRY1 Antibody - N-terminal region (ARP59758_P050)

• Product Number: ARP59758_P050
• Name: CRY1 Antibody - N-terminal region (ARP59758_P050)
• Protein Size (# AA): 586 amino acids
• Molecular Weight: 64kDa
• NCBI Gene Id: 1407
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Cryptochrome 1 (photolyase-like)
• Alias Symbols: DSPD, PHLL1
• Peptide Sequence: Synthetic peptide located within the following region: KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: CRY1 is the blue light-dependent regulator of the circadian feedback loop. CRY1 inhibits CLOCK NPAS2-ARNTL E box-mediated transcription. CRY1 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. CRY1 has no photolyase activity. CRY1 is capable of translocating circadian clock core proteins such as PER proteins to the nucleus. CRY1 may inhibit CLOCK NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.
• Protein Interactions: PER2; FBXL3; FBXL21; PLSCR1; BTRC; CUL1; SKP1; CSNK1E; LTBP4; UBC; SNRPD3; GRN; USP2; Timeless; Cry1; KRTAP4-12; PER3; MDFI; CBLB; ARNTL; PER1; TRAF2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CRY1 (ARP59758_P050) antibody is Catalog # AAPP45928
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CRY1
• Uniprot ID: Q16526
• Protein Name: Cryptochrome-1
• Publications:

  Deep-brain photoreception links luminance detection to motor output in Xenopus frog tadpoles. Proc. Natl. Acad. Sci. U.S.A. 113, 6053-8 (2016). 27166423

• Protein Accession #: NP_004066
• Purification: Affinity Purified
• Nucleotide Accession #: NM_004075
• Tested Species Reactivity: Human
• Gene Symbol: CRY1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
• Image 1: Human Testis
  
  Immunohistochemistry with Testis tissue at an antibody concentration of 5ug/ml using anti-CRY1 antibody (ARP59758_P050)
• Image 2: Human Liver Tumor
  
  Host: Rabbit
  Target Name: CRY1
  Sample Tissue: Human Liver Tumor
  Antibody Dilution: 1ug/ml
• Image 3: Human Hela Whole Cell
  
  Host: Rabbit
  Target Name: CRY1
  Sample Tissue: Human Hela Whole Cell
  Antibody Dilution: 1ug/ml
• Image 4: Hela Whole cell
  
  Host: Rabbit
  Target Name: CRY1
  Sample Type: Hela Whole cell
  Lane A: Primary Antibody
  Lane B: Primary Antibody + Blocking Peptide
  Primary Antibody Concentration: 1ug/ml
  Peptide Concentration: 5ug/ml
  Lysate Quantity: 25ug/lane
  Gel Concentration: 0.12%