Search Antibody, Protein, and ELISA Kit Solutions

CRADD Antibody - middle region : FITC (ARP72806_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72806_P050 Unconjugated

ARP72806_P050-HRP Conjugated

ARP72806_P050-Biotin Conjugated

Gene Symbol:
CRADD
NCBI Gene Id:
8738
Swissprot Id:
P78560
Protein Accession #:
NP_003796
Alias Symbols:
CRADD, RAIDD,
Replacement Item:
This antibody may replace item sc-122950 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a death domain (CARD/DD)-containing protein and has been shown to induce cell apoptosis. Through its CARD domain, this protein interacts with, and thus recruits, caspase 2/ICH1 to the cell death signal transduction complex that includes tumor necrosis factor receptor 1 (TNFR1A), RIPK1/RIP kinase, and numbers of other CARD domain-containing proteins.
Protein Size (# AA):
199
Molecular Weight:
21kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CRADD.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CRADD.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human CRADD
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: PAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
BBS5; TRIM54; APPL2; KCTD9; CASP2; PIDD1; CRYAB; DCXR; SLC35A3; VTN; KPNA1; IL9R; APP; MYC; LRIF1; CCSER2; C14orf1; RIPK1; CASP8; EEF1A1; TNFRSF1A; ced-3;
Blocking Peptide:
For anti-CRADD (ARP72806_P050-FITC) antibody is Catalog # AAP72806
Datasheets/Manuals:
Printable datasheet for anti-CRADD (ARP72806_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...