Size:100 ul
$289.00
In Stock
SKU
ARP72806_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP72806_P050 Unconjugated

ARP72806_P050-HRP Conjugated

ARP72806_P050-Biotin Conjugated

CRADD Antibody - middle region : FITC (ARP72806_P050-FITC)

Catalog#: ARP72806_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC (FAM): Excitation 495 nm/ Emission 520 nm
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement ItemThis antibody may replace item sc-122950 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human CRADD
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: PAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYR
Concentration0.5 mg/ml
Blocking PeptideFor anti-CRADD (ARP72806_P050-FITC) antibody is Catalog # AAP72806
Datasheets/ManualsPrintable datasheet for anti-CRADD (ARP72806_P050-FITC) antibody
Gene SymbolCRADD
Alias SymbolsCRADD, RAIDD,
NCBI Gene Id8738
Description of TargetThe protein encoded by this gene is a death domain (CARD/DD)-containing protein and has been shown to induce cell apoptosis. Through its CARD domain, this protein interacts with, and thus recruits, caspase 2/ICH1 to the cell death signal transduction complex that includes tumor necrosis factor receptor 1 (TNFR1A), RIPK1/RIP kinase, and numbers of other CARD domain-containing proteins.
Swissprot IdP78560
Protein Accession #NP_003796
Protein Size (# AA)199
Molecular Weight21kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CRADD.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CRADD.
Protein InteractionsBBS5; TRIM54; APPL2; KCTD9; CASP2; PIDD1; CRYAB; DCXR; SLC35A3; VTN; KPNA1; IL9R; APP; MYC; LRIF1; CCSER2; C14orf1; RIPK1; CASP8; EEF1A1; TNFRSF1A; ced-3;
Write Your Own Review
You're reviewing:CRADD Antibody - middle region : FITC (ARP72806_P050-FITC)
Your Rating
Free Microscope
Aviva Tissue Tool
Aviva Live Chat
Aviva Travel Grant