CRADD Antibody - middle region : FITC (ARP72806_P050-FITC)

• Product Number: ARP72806_P050-FITC
• Name: CRADD Antibody - middle region : FITC (ARP72806_P050-FITC)
• Protein Size (# AA): 199 amino acids
• Molecular Weight: 21kDa
• Conjugation: FITC: Fluorescein Isothiocyanate
• NCBI Gene Id: 8738
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: MRT34, RAIDD
• Peptide Sequence: Synthetic peptide located within the following region: PAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Description of Target: The protein encoded by this gene is a death domain (CARD/DD)-containing protein and has been shown to induce cell apoptosis. Through its CARD domain, this protein interacts with, and thus recruits, caspase 2/ICH1 to the cell death signal transduction complex that includes tumor necrosis factor receptor 1 (TNFR1A), RIPK1/RIP kinase, and numbers of other CARD domain-containing proteins.
• Protein Interactions: BBS5; TRIM54; APPL2; KCTD9; CASP2; PIDD1; CRYAB; DCXR; SLC35A3; VTN; KPNA1; IL9R; APP; MYC; LRIF1; CCSER2; C14orf1; RIPK1; CASP8; EEF1A1; TNFRSF1A; ced-3;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-CRADD (ARP72806_P050-FITC) antibody is Catalog # AAP72806
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CRADD
• Uniprot ID: P78560
• Protein Accession #: NP_003796
• Purification: Affinity Purified
• Gene Symbol: CRADD
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: