Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

CHES1 Antibody - C-terminal region (ARP32841_T100)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32841_T100-FITC Conjugated

ARP32841_T100-HRP Conjugated

ARP32841_T100-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
Forkhead box N3
NCBI Gene Id:
Protein Name:
Forkhead box protein N3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CHES1, PRO1635, C14orf116
Description of Target:
Checkpoint suppressor 1 is a member of the forkhead/winged helix transcription factor family. Checkpoints are eukaryotic DNA damage-inducible cell cycle arrests at G1 and G2. Checkpoint suppressor 1 suppresses multiple yeast checkpoint mutations including mec1, rad9, rad53 and dun1 by activating a MEC1-independent checkpoint pathway.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CHES1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CHES1.
The immunogen is a synthetic peptide directed towards the C terminal region of human CHES1
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-CHES1 (ARP32841_T100)
Peptide Sequence:
Synthetic peptide located within the following region: SGYASQHKKRQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FOXN3 (ARP32841_T100) antibody is Catalog # AAP32841 (Previous Catalog # AAPP03861)
Printable datasheet for anti-FOXN3 (ARP32841_T100) antibody
Sample Type Confirmation:

FOXN3 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Yu,Y., et al., (2001) Genome Res. 11 (8), 1392-1403

Huot, G. et al. CHES1/FOXN3 regulates cell proliferation by repressing PIM2 and protein biosynthesis. Mol. Biol. Cell 25, 554-65 (2014). WB, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24403608

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...