CHES1 Antibody - C-terminal region : FITC (ARP32841_T100-FITC)

Catalog No: ARP32841_T100-FITC

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CHES1
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SGYASQHKKRQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FOXN3 (ARP32841_T100-FITC) antibody is Catalog # AAP32841 (Previous Catalog # AAPP03861)
• Sample Type Confirmation:

  FOXN3 is strongly supported by BioGPS gene expression data to be expressed in HepG2

• Reference: Yu,Y., et al., (2001) Genome Res. 11 (8), 1392-1403
• Publications:

  Huot, G. et al. CHES1/FOXN3 regulates cell proliferation by repressing PIM2 and protein biosynthesis. Mol. Biol. Cell 25, 554-65 (2014). WB, Rat, Pig, Horse, Rabbit, Guinea pig, Dog, Zebrafish, Human, Mouse 24403608

Target Info

• Gene Symbol: FOXN3
• Gene Full Name: Forkhead box N3
• Alias Symbols: CHES1, PRO1635, C14orf116
• NCBI Gene Id: 1112
• Protein Name: Forkhead box protein N3
• Description of Target: Checkpoint suppressor 1 is a member of the forkhead/winged helix transcription factor family. Checkpoints are eukaryotic DNA damage-inducible cell cycle arrests at G1 and G2. Checkpoint suppressor 1 suppresses multiple yeast checkpoint mutations including mec1, rad9, rad53 and dun1 by activating a MEC1-independent checkpoint pathway.
• Uniprot ID: O00409
• Protein Accession #: NP_005188
• Nucleotide Accession #: NM_005197
• Protein Size (# AA): 468
• Molecular Weight: 52kDa
• Protein Interactions: EXOSC8; SRPK2; ELAVL1; MEN1;