SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP57855_P050
Price: $0.00
SKU
ARP57855_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

FOXN3 Antibody - middle region (ARP57855_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-FOXN3 (ARP57855_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FOXN3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 79%; Guinea Pig: 85%; Horse: 85%; Human: 100%; Rabbit: 85%; Rat: 85%
Peptide SequenceSynthetic peptide located within the following region: EGSFRSHESPSDTEEDDRKHSQKEPKDSLGDSGYASQHKKRQHFAKARKV
Concentration0.5 mg/ml
Blocking PeptideFor anti-FOXN3 (ARP57855_P050) antibody is Catalog # AAP57855 (Previous Catalog # AAPP44671)
Gene SymbolFOXN3
Gene Full NameForkhead box N3
Alias SymbolsCHES1, PRO1635, C14orf116
NCBI Gene Id1112
Protein NameForkhead box protein N3
Description of TargetFOXN3 gene is a member of the forkhead/winged helix transcription factor family. Checkpoints are eukaryotic DNA damage-inducible cell cycle arrests at G1 and G2. Checkpoint suppressor 1 suppresses multiple yeast checkpoint mutations including mec1, rad9, rad53 and dun1 by activating a MEC1-independent checkpoint pathway. Alternative splicing is observed at the locus, resulting in distinct isoforms.
Uniprot IDO00409
Protein Accession #NP_005188
Nucleotide Accession #NM_005197
Protein Size (# AA)468
Molecular Weight51kDa
Protein InteractionsEXOSC8; SRPK2; ELAVL1; MEN1;
  1. What is the species homology for "FOXN3 Antibody - middle region (ARP57855_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "FOXN3 Antibody - middle region (ARP57855_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FOXN3 Antibody - middle region (ARP57855_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FOXN3 Antibody - middle region (ARP57855_P050)"?

    This target may also be called "CHES1, PRO1635, C14orf116" in publications.

  5. What is the shipping cost for "FOXN3 Antibody - middle region (ARP57855_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FOXN3 Antibody - middle region (ARP57855_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FOXN3 Antibody - middle region (ARP57855_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "51kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FOXN3 Antibody - middle region (ARP57855_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "FOXN3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FOXN3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FOXN3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FOXN3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FOXN3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FOXN3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FOXN3 Antibody - middle region (ARP57855_P050)
Your Rating
We found other products you might like!