Search Antibody, Protein, and ELISA Kit Solutions

CFAP45 Antibody - N-terminal region : HRP (ARP51322_P050-HRP)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP51322_P050 Unconjugated

ARP51322_P050-FITC Conjugated

ARP51322_P050-Biotin Conjugated

Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
HRP
Application:
WB
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item:
This antibody may replace item sc-142093 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC19
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 77%; Guinea Pig: 92%; Horse: 85%; Human: 100%; Rabbit: 85%; Rat: 92%
Complete computational species homology data:
Anti-CCDC19 (ARP51322_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SLIISPEEFERIKWASHVLTREELEARDQAFKKEKEATMDAVMTRKKIMK
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-CFAP45 (ARP51322_P050-HRP) antibody is Catalog # AAP51322 (Previous Catalog # AAPS23411)
Datasheets/Manuals:
Printable datasheet for anti-CFAP45 (ARP51322_P050-HRP) antibody
Gene Symbol:
CFAP45
Official Gene Full Name:
cilia and flagella associated protein 45
Alias Symbols:
NESG1, CCDC19
NCBI Gene Id:
25790
Protein Name:
cilia- and flagella-associated protein 45
Swissprot Id:
Q05BA3
Protein Accession #:
AAH89391
Nucleotide Accession #:
NM_012337
Protein Size (# AA):
466
Molecular Weight:
50kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CFAP45.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CFAP45.
Protein Interactions:
ELAVL1; H2AFX;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...