Search Antibody, Protein, and ELISA Kit Solutions

CFAP45 Antibody - N-terminal region (ARP51321_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP51321_P050-FITC Conjugated

ARP51321_P050-HRP Conjugated

ARP51321_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Rat, Yeast
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-142093 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC19
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Dog: 85%; Guinea Pig: 85%; Horse: 85%; Human: 100%; Rat: 85%; Yeast: 79%
Complete computational species homology data:
Anti-CCDC19 (ARP51321_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MPLSTAGILSSSSAASNRSRNKARYRTKAVSSEVDESLFGDIKSPAQGQS
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CFAP45 (ARP51321_P050) antibody is Catalog # AAP51321 (Previous Catalog # AAPS23410)
Datasheets/Manuals:
Printable datasheet for anti-CFAP45 (ARP51321_P050) antibody
Target Reference:
Li,Z., (1999) Gene 237 (1), 235-240
Gene Symbol:
CFAP45
Official Gene Full Name:
cilia and flagella associated protein 45
Alias Symbols:
NESG1, CCDC19
NCBI Gene Id:
25790
Protein Name:
cilia- and flagella-associated protein 45
Swissprot Id:
Q5VU18
Protein Accession #:
NP_036469
Nucleotide Accession #:
NM_012337
Protein Size (# AA):
551
Molecular Weight:
66kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CFAP45.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CFAP45.
Protein Interactions:
ELAVL1; H2AFX;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...