Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP51322_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP51322_P050-FITC Conjugated

ARP51322_P050-HRP Conjugated

ARP51322_P050-Biotin Conjugated

CFAP45 Antibody - N-terminal region (ARP51322_P050)

Rating:
80% of 100
Catalog#: ARP51322_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-142093 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC19
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 77%; Guinea Pig: 92%; Horse: 85%; Human: 100%; Rabbit: 85%; Rat: 92%
Complete computational species homology data Anti-CCDC19 (ARP51322_P050)
Peptide Sequence Synthetic peptide located within the following region: SLIISPEEFERIKWASHVLTREELEARDQAFKKEKEATMDAVMTRKKIMK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CFAP45 (ARP51322_P050) antibody is Catalog # AAP51322 (Previous Catalog # AAPS23411)
Datasheets/Manuals Printable datasheet for anti-CFAP45 (ARP51322_P050) antibody
Gene Symbol CFAP45
Official Gene Full Name cilia and flagella associated protein 45
Alias Symbols NESG1, CCDC19
NCBI Gene Id 25790
Protein Name cilia- and flagella-associated protein 45
Swissprot Id Q05BA3
Protein Accession # AAH89391
Nucleotide Accession # NM_012337
Protein Size (# AA) 466
Molecular Weight 50kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CFAP45.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CFAP45.
Protein Interactions ELAVL1; H2AFX;
Write Your Own Review
You're reviewing:CFAP45 Antibody - N-terminal region (ARP51322_P050)
Your Rating