Search Antibody, Protein, and ELISA Kit Solutions

CFAP45 Antibody - N-terminal region (ARP51322_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP51322_P050-FITC Conjugated

ARP51322_P050-HRP Conjugated

ARP51322_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
CFAP45
Official Gene Full Name:
cilia and flagella associated protein 45
NCBI Gene Id:
25790
Protein Name:
cilia- and flagella-associated protein 45
Swissprot Id:
Q05BA3
Protein Accession #:
AAH89391
Nucleotide Accession #:
NM_012337
Alias Symbols:
NESG1, CCDC19
Replacement Item:
This antibody may replace item sc-142093 from Santa Cruz Biotechnology.
Protein Size (# AA):
466
Molecular Weight:
50kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CFAP45.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CFAP45.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC19
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 77%; Guinea Pig: 92%; Horse: 85%; Human: 100%; Rabbit: 85%; Rat: 92%
Complete computational species homology data:
Anti-CCDC19 (ARP51322_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SLIISPEEFERIKWASHVLTREELEARDQAFKKEKEATMDAVMTRKKIMK
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ELAVL1; H2AFX;
Blocking Peptide:
For anti-CFAP45 (ARP51322_P050) antibody is Catalog # AAP51322 (Previous Catalog # AAPS23411)
Datasheets/Manuals:
Printable datasheet for anti-CFAP45 (ARP51322_P050) antibody

Product Reviews

Average Rating:
1 review
5 star
0
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

78/03/2019 03:09
  • Overall Experience:
  • Quality:
Nasal Respiratory cells in IF

Submitted by:
Sudipto Roy
Institute of Molecular and Cell Biology (IMCB)

CFAP45

1. Species and tissue/cell type used: Nasal Respiratory cells

2. Fixation method: Paraformaldehyde

3. Antigen retrieval method: None.

4. Primary antibody dilution: 1:250, 1 hour RT.

5. Secondary antibody and dilution: Anti Rabbit 488, 1:250, 1 hour RT.

6. Stain/counterstain:
CFAP45 - Green
Acetylated tubulin - Red

7. Protocol:
- Wash with PBS
- Permeabilize using Triton
- Blocking using 2%BSA overnight
- Wash with PBS
- Primary Ab staining for 1 hour
- Washing with PBS
- Secondary Ab staining for 1 hour
- Washing with PBS
- Mount with vetashield

0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...