ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: ARP58604_P050
Price: $0.00
SKU
ARP58604_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CAPZA3 (ARP58604_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CAPZA3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 92%; Guinea Pig: 92%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 85%
Peptide SequenceSynthetic peptide located within the following region: MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGEC
Concentration0.5 mg/ml
Blocking PeptideFor anti-CAPZA3 (ARP58604_P050) antibody is Catalog # AAP58604 (Previous Catalog # AAPP35741)
Subunitalpha-3
ReferenceMiyagawa,Y., (2002) Mol. Hum. Reprod. 8 (6), 531-539
Gene SymbolCAPZA3
Gene Full NameCapping protein (actin filament) muscle Z-line, alpha 3
Alias SymbolsGsg3, CAPPA3, HEL-S-86
NCBI Gene Id93661
Protein NameF-actin-capping protein subunit alpha-3
Description of TargetF-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. CAPZA3 may play a role in the morphogenesis of spermatid.This gene encodes an actin capping protein, one of the F-actin capping protein alpha subunit family. The encoded protein is predominantly localized to the neck region of ejaculated sperm, other immunohistochemical signals were found in the tail and postacrosomal regions. The encoded protein may also form heterodimers of alpha and beta subunits. This protein may be important in determining sperm architecture and male fertility.
Uniprot IDQ96KX2
Protein Accession #NP_201585
Nucleotide Accession #NM_033328
Protein Size (# AA)299
Molecular Weight33kDa
Protein InteractionsUBC; CAPZA2; ACTG1;
  1. What is the species homology for "CAPZA3 Antibody - N-terminal region (ARP58604_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Rabbit".

  2. How long will it take to receive "CAPZA3 Antibody - N-terminal region (ARP58604_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CAPZA3 Antibody - N-terminal region (ARP58604_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CAPZA3 Antibody - N-terminal region (ARP58604_P050)"?

    This target may also be called "Gsg3, CAPPA3, HEL-S-86" in publications.

  5. What is the shipping cost for "CAPZA3 Antibody - N-terminal region (ARP58604_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CAPZA3 Antibody - N-terminal region (ARP58604_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CAPZA3 Antibody - N-terminal region (ARP58604_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "33kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CAPZA3 Antibody - N-terminal region (ARP58604_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CAPZA3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CAPZA3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CAPZA3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CAPZA3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CAPZA3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CAPZA3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CAPZA3 Antibody - N-terminal region (ARP58604_P050)
Your Rating