| Product Number |
ARP58604_P050 |
| Product Page |
www.avivasysbio.com/capza3-antibody-n-terminal-region-arp58604-p050.html |
| Name |
CAPZA3 Antibody - N-terminal region (ARP58604_P050) |
| Protein Size (# AA) |
299 amino acids |
| Molecular Weight |
33kDa |
| Subunit |
alpha-3 |
| NCBI Gene Id |
93661 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Capping protein (actin filament) muscle Z-line, alpha 3 |
| Alias Symbols |
Gsg3, CAPPA3, HEL-S-86 |
| Peptide Sequence |
Synthetic peptide located within the following region: MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGEC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Miyagawa,Y., (2002) Mol. Hum. Reprod. 8 (6), 531-539 |
| Description of Target |
F-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. CAPZA3 may play a role in the morphogenesis of spermatid.This gene encodes an actin capping protein, one of the F-actin capping protein alpha subunit family. The encoded protein is predominantly localized to the neck region of ejaculated sperm, other immunohistochemical signals were found in the tail and postacrosomal regions. The encoded protein may also form heterodimers of alpha and beta subunits. This protein may be important in determining sperm architecture and male fertility. |
| Protein Interactions |
UBC; CAPZA2; ACTG1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CAPZA3 (ARP58604_P050) antibody |
| Blocking Peptide |
For anti-CAPZA3 (ARP58604_P050) antibody is Catalog # AAP58604 (Previous Catalog # AAPP35741) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CAPZA3 |
| Uniprot ID |
Q96KX2 |
| Protein Name |
F-actin-capping protein subunit alpha-3 |
| Protein Accession # |
NP_201585 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_033328 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CAPZA3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 92%; Guinea Pig: 92%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 85% |
| Image 1 | Human DU145
 | WB Suggested Anti-CAPZA3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: DU145 cell lysate |
|
|
