Search Antibody, Protein, and ELISA Kit Solutions

CACNA2D1 Antibody - middle region (ARP34952_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34952_P050-FITC Conjugated

ARP34952_P050-HRP Conjugated

ARP34952_P050-Biotin Conjugated

Gene Symbol:
CACNA2D1
Official Gene Full Name:
Calcium channel, voltage-dependent, alpha 2/delta subunit 1
NCBI Gene Id:
781
Protein Name:
Voltage-dependent calcium channel subunit alpha-2/delta-1
Swissprot Id:
P54289
Protein Accession #:
NP_000713
Nucleotide Accession #:
NM_000722
Alias Symbols:
CACNA2, CCHL2A, CACNL2A
Replacement Item:
This antibody may replace item sc-104118 from Santa Cruz Biotechnology.
Description of Target:
CACNA2D1 encodes a member of the alpha-2/delta subunit family, a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio.
Protein Size (# AA):
1091
Molecular Weight:
120kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CACNA2D1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CACNA2D1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CACNA2D1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-CACNA2D1 (ARP34952_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
STT3B; RAB11A; NDUFS4; Cep76;
Blocking Peptide:
For anti-CACNA2D1 (ARP34952_P050) antibody is Catalog # AAP34952 (Previous Catalog # AAPP06175)
Datasheets/Manuals:
Printable datasheet for anti-CACNA2D1 (ARP34952_P050) antibody
Subunit:
alpha-2/delta-1
Target Reference:
Stotz,S.C., et al., (2004) J. Biol. Chem. 279 (5), 3793-3800
Publications:

Tétreault, MP; Bourdin, B; Briot, J; Segura, E; Lesage, S; Fiset, C; Parent, L; Identification of Glycosylation Sites Essential for Surface Expression of the CaVα2δ1 Subunit and Modulation of the Cardiac CaV1.2 Channel Activity. 291, 4826-43 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26742847

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...