Size:100 ul
$319.00
In stock
SKU
ARP34952_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34952_P050-FITC Conjugated

ARP34952_P050-HRP Conjugated

ARP34952_P050-Biotin Conjugated

CACNA2D1 Antibody - middle region (ARP34952_P050)

Catalog#: ARP34952_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-104118 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CACNA2D1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-CACNA2D1 (ARP34952_P050)
Peptide Sequence Synthetic peptide located within the following region: PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CACNA2D1 (ARP34952_P050) antibody is Catalog # AAP34952 (Previous Catalog # AAPP06175)
Datasheets/Manuals Printable datasheet for anti-CACNA2D1 (ARP34952_P050) antibody
Subunit alpha-2/delta-1
Target Reference Stotz,S.C., et al., (2004) J. Biol. Chem. 279 (5), 3793-3800
Publications

Tétreault, MP; Bourdin, B; Briot, J; Segura, E; Lesage, S; Fiset, C; Parent, L; Identification of Glycosylation Sites Essential for Surface Expression of the CaVα2δ1 Subunit and Modulation of the Cardiac CaV1.2 Channel Activity. 291, 4826-43 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26742847

Gene Symbol CACNA2D1
Official Gene Full Name Calcium channel, voltage-dependent, alpha 2/delta subunit 1
Alias Symbols CACNA2, CCHL2A, CACNL2A
NCBI Gene Id 781
Protein Name Voltage-dependent calcium channel subunit alpha-2/delta-1
Description of Target CACNA2D1 encodes a member of the alpha-2/delta subunit family, a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio.
Swissprot Id P54289
Protein Accession # NP_000713
Nucleotide Accession # NM_000722
Protein Size (# AA) 1091
Molecular Weight 120kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CACNA2D1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CACNA2D1.
Protein Interactions STT3B; RAB11A; NDUFS4; Cep76;
Write Your Own Review
You're reviewing:CACNA2D1 Antibody - middle region (ARP34952_P050)
Your Rating