CACNA2D1 Antibody - middle region : FITC (ARP34952_P050-FITC)

Catalog No: ARP34952_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CACNA2D1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CACNA2D1 (ARP34952_P050-FITC) antibody is Catalog # AAP34952 (Previous Catalog # AAPP06175)
• Subunit: alpha-2/delta-1
• Reference: Stotz,S.C., et al., (2004) J. Biol. Chem. 279 (5), 3793-3800

Target Info

• Gene Symbol: CACNA2D1
• Gene Full Name: Calcium channel, voltage-dependent, alpha 2/delta subunit 1
• Alias Symbols: CACNA2, CCHL2A, CACNL2A, LINC01112, lncRNA-N3
• NCBI Gene Id: 781
• Protein Name: Voltage-dependent calcium channel subunit alpha-2/delta-1
• Description of Target: CACNA2D1 encodes a member of the alpha-2/delta subunit family, a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio.
• Uniprot ID: P54289
• Protein Accession #: NP_000713
• Nucleotide Accession #: NM_000722
• Protein Size (# AA): 1091
• Molecular Weight: 120kDa
• Protein Interactions: STT3B; RAB11A; NDUFS4; Cep76;