Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP33575_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33575_P050-FITC Conjugated

ARP33575_P050-HRP Conjugated

ARP33575_P050-Biotin Conjugated

Bhlhe41 Antibody - N-terminal region (ARP33575_P050)

Catalog#: ARP33575_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Rat
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-373763 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data Anti-Bhlhe41 (ARP33575_P050)
Peptide Sequence Synthetic peptide located within the following region: QLLEHRDFIGLDYSSLYMCKPKRSLKRDDTKDTYKLPHRLIEKKRRDRIN
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Bhlhe41 (ARP33575_P050) antibody is Catalog # AAP33575 (Previous Catalog # AAPP04630)
Datasheets/Manuals Printable datasheet for anti-Bhlhe41 (ARP33575_P050) antibody
Publications

Blondelle, J; Shapiro, P; Domenighetti, AA; Lange, S; Cullin E3 Ligase Activity Is Required for Myoblast Differentiation. 429, 1045-1066 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 28238764

Gene Symbol Bhlhe41
Official Gene Full Name Basic helix-loop-helix family, member e41
Alias Symbols Bhlhb3, Dec2, SHARP-1, Sharp1
NCBI Gene Id 117095
Description of Target Bhlhe41 may be a transcriptional repressor that represses both basal and activated transcription.
Swissprot Id O35779
Protein Accession # XP_001074956
Nucleotide Accession # XM_001074956
Protein Size (# AA) 305
Molecular Weight 33kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Bhlhe41.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Bhlhe41.
Write Your Own Review
You're reviewing:Bhlhe41 Antibody - N-terminal region (ARP33575_P050)
Your Rating