Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

Bhlhe41 Antibody - N-terminal region (ARP33575_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33575_P050-FITC Conjugated

ARP33575_P050-HRP Conjugated

ARP33575_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Basic helix-loop-helix family, member e41
NCBI Gene Id:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Bhlhb3, Dec2, SHARP-1, Sharp1
Replacement Item:
This antibody may replace item sc-373763 from Santa Cruz Biotechnology.
Description of Target:
Bhlhe41 may be a transcriptional repressor that represses both basal and activated transcription.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Bhlhe41.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Bhlhe41.
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-Bhlhe41 (ARP33575_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QLLEHRDFIGLDYSSLYMCKPKRSLKRDDTKDTYKLPHRLIEKKRRDRIN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Bhlhe41 (ARP33575_P050) antibody is Catalog # AAP33575 (Previous Catalog # AAPP04630)
Printable datasheet for anti-Bhlhe41 (ARP33575_P050) antibody

Blondelle, J; Shapiro, P; Domenighetti, AA; Lange, S; Cullin E3 Ligase Activity Is Required for Myoblast Differentiation. 429, 1045-1066 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 28238764

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...