| Product Number |
ARP33575_P050 |
| Product Page |
www.avivasysbio.com/bhlhe41-antibody-n-terminal-region-arp33575-p050.html |
| Name |
Bhlhe41 Antibody - N-terminal region (ARP33575_P050) |
| Protein Size (# AA) |
305 amino acids |
| Molecular Weight |
33kDa |
| NCBI Gene Id |
117095 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Basic helix-loop-helix family, member e41 |
| Alias Symbols |
Dec2, Bhlhb3, Sharp1, SHARP-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: QLLEHRDFIGLDYSSLYMCKPKRSLKRDDTKDTYKLPHRLIEKKRRDRIN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Bhlhe41 may be a transcriptional repressor that represses both basal and activated transcription. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Bhlhe41 (ARP33575_P050) antibody |
| Blocking Peptide |
For anti-Bhlhe41 (ARP33575_P050) antibody is Catalog # AAP33575 (Previous Catalog # AAPP04630) |
| Uniprot ID |
O35779 |
| Publications |
Cullin E3 Ligase Activity Is Required for Myoblast Differentiation. J. Mol. Biol. 429, 1045-1066 (2017). 28238764 |
| Protein Accession # |
XP_001074956 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
XM_001074956 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Bhlhe41 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
| Image 1 | Rat Muscle
 | WB Suggested Anti-Bhlhe41 Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Muscle |
|
|
