Bhlhe41 Peptide - N-terminal region (AAP33575)

Data Sheet
 
Sku AAP33575
Old sku AAPP04630
Price $99.00
Name Bhlhe41 Peptide - N-terminal region (AAP33575)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene Bhlhe41
Alias symbols Bhlhb3, Dec2, SHARP-1, Sharp1
Gene id 117095
Description of target Bhlhe41 may be a transcriptional repressor that represses both basal and activated transcription.
Protein accession num XP_001074956
Nucleotide accession num XM_001074956
Protein size 305 amino acids
Molecular weight 33kDa
Species reactivity Rat
Application WB
Peptide sequence QLLEHRDFIGLDYSSLYMCKPKRSLKRDDTKDTYKLPHRLIEKKRRDRIN
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-Bhlhe41 Antibody (ARP33575_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com