Search Antibody, Protein, and ELISA Kit Solutions

BGN Antibody - middle region (ARP87249_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
BGN
Official Gene Full Name:
biglycan
NCBI Gene Id:
633
Protein Name:
Biglycan
Swissprot Id:
P21810
Protein Accession #:
NP_001702.1
Nucleotide Accession #:
NM_001711.5
Alias Symbols:
PGI, MRLS, DSPG1, PG-S1, SEMDX, SLRR1A
Description of Target:
This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in bone growth, muscle development and regeneration, and collagen fibril assembly in multiple tissues. This protein may also regulate inflammation and innate immunity. Additionally, the encoded protein may contribute to atherosclerosis and aortic valve stenosis in human patients. This gene and the related gene decorin are thought to be the result of a gene duplication.
Protein Size (# AA):
368
Molecular Weight:
42 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DNTTIP2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BGN.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human BGN
Peptide Sequence:
Synthetic peptide located within the following region: DTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKL
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-BGN (ARP87249_P050) antibody is Catalog # AAP87249
Datasheets/Manuals:
Printable datasheet for anti-BGN (ARP87249_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...