Search Antibody, Protein, and ELISA Kit Solutions

BGN Antibody - middle region (ARP87249_P050)

100 ul
In Stock
Request Bulk Order Quote

Gene Symbol:
Official Gene Full Name:
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in bone growth, muscle development and regeneration, and collagen fibril assembly in multiple tissues. This protein may also regulate inflammation and innate immunity. Additionally, the encoded protein may contribute to atherosclerosis and aortic valve stenosis in human patients. This gene and the related gene decorin are thought to be the result of a gene duplication.
Protein Size (# AA):
Molecular Weight:
42 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DNTTIP2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BGN.
The immunogen is a synthetic peptide directed towards the middle region of human BGN
Predicted Species Reactivity:
Tested Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: DTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-BGN (ARP87249_P050) antibody is Catalog # AAP87249
Printable datasheet for anti-BGN (ARP87249_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...