BGN Antibody - middle region (ARP87249_P050)

Catalog No: ARP87249_P050

Host: Rabbit
Target Name: BGN
Sample Tissue: Human RPMI 8226 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BGN
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: DTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BGN (ARP87249_P050) antibody is Catalog # AAP87249

Target Info

• Gene Symbol: BGN
• Gene Full Name: biglycan
• Alias Symbols: PGI, MRLS, DSPG1, PG-S1, SEMDX, SLRR1A
• NCBI Gene Id: 633
• Protein Name: Biglycan
• Description of Target: This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in bone growth, muscle development and regeneration, and collagen fibril assembly in multiple tissues. This protein may also regulate inflammation and innate immunity. Additionally, the encoded protein may contribute to atherosclerosis and aortic valve stenosis in human patients. This gene and the related gene decorin are thought to be the result of a gene duplication.
• Uniprot ID: P21810
• Protein Accession #: NP_001702.1
• Nucleotide Accession #: NM_001711.5
• Protein Size (# AA): 368
• Molecular Weight: 42 kDa