Product Number |
ARP87249_P050 |
Product Page |
www.avivasysbio.com/bgn-antibody-middle-region-arp87249-p050.html |
Name |
BGN Antibody - middle region (ARP87249_P050) |
Protein Size (# AA) |
368 amino acids |
Molecular Weight |
42 kDa |
NCBI Gene Id |
633 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
biglycan |
Alias Symbols |
PGI, MRLS, DSPG1, PG-S1, SEMDX, SLRR1A |
Peptide Sequence |
Synthetic peptide located within the following region: DTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in bone growth, muscle development and regeneration, and collagen fibril assembly in multiple tissues. This protein may also regulate inflammation and innate immunity. Additionally, the encoded protein may contribute to atherosclerosis and aortic valve stenosis in human patients. This gene and the related gene decorin are thought to be the result of a gene duplication. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-BGN (ARP87249_P050) antibody |
Blocking Peptide |
For anti-BGN (ARP87249_P050) antibody is Catalog # AAP87249 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human BGN |
Uniprot ID |
P21810 |
Protein Name |
Biglycan |
Protein Accession # |
NP_001702.1 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_001711.5 |
Tested Species Reactivity |
Human |
Gene Symbol |
BGN |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human RPMI 8226 Whole Cell
| Host: Rabbit Target Name: BGN Sample Tissue: Human RPMI 8226 Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|