BGN Antibody - middle region (ARP87249_P050)

Data Sheet
 
Product Number ARP87249_P050
Product Page www.avivasysbio.com/bgn-antibody-middle-region-arp87249-p050.html
Name BGN Antibody - middle region (ARP87249_P050)
Protein Size (# AA) 368 amino acids
Molecular Weight 42 kDa
NCBI Gene Id 633
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name biglycan
Alias Symbols PGI, MRLS, DSPG1, PG-S1, SEMDX, SLRR1A
Peptide Sequence Synthetic peptide located within the following region: DTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in bone growth, muscle development and regeneration, and collagen fibril assembly in multiple tissues. This protein may also regulate inflammation and innate immunity. Additionally, the encoded protein may contribute to atherosclerosis and aortic valve stenosis in human patients. This gene and the related gene decorin are thought to be the result of a gene duplication.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-BGN (ARP87249_P050) antibody
Blocking Peptide For anti-BGN (ARP87249_P050) antibody is Catalog # AAP87249
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human BGN
Uniprot ID P21810
Protein Name Biglycan
Protein Accession # NP_001702.1
Purification Affinity purified
Nucleotide Accession # NM_001711.5
Tested Species Reactivity Human
Gene Symbol BGN
Predicted Species Reactivity Human
Application WB
Image 1
Human RPMI 8226 Whole Cell
Host: Rabbit
Target Name: BGN
Sample Tissue: Human RPMI 8226 Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com