Search Antibody, Protein, and ELISA Kit Solutions

BDNF Antibody - N-terminal region (ARP41969_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41969_P050-FITC Conjugated

ARP41969_P050-HRP Conjugated

ARP41969_P050-Biotin Conjugated

Gene Symbol:
BDNF
NCBI Gene Id:
627
Official Gene Full Name:
brain-derived neurotrophic factor
Protein Name:
Brain-derived neurotrophic factor
Swissprot Id:
P23560-4
Replacement Item:
This antibody may replace item sc-20981 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene.
Protein Size (# AA):
329
Molecular Weight:
36kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BDNF.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BDNF.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human BDNF
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-BDNF (ARP41969_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; AGO3; INPP5K; F11R; JUNB; APP; ELAVL1; Ntrk2; CADPS2; MBTPS1; SORT1; NOS3; NTF4; NTF3; ESR1; NCAM1; CPE; BDNF;
Blocking Peptide:
For anti-BDNF (ARP41969_P050) antibody is Catalog # AAP41969
Datasheets/Manuals:
Printable datasheet for anti-BDNF (ARP41969_P050) antibody
Publications:

Galindo, CL; Soslow, JH; Brinkmeyer-Langford, CL; Gupte, M; Smith, HM; Sengsayadeth, S; Sawyer, DB; Benson, DW; Kornegay, JN; Markham, LW; Translating golden retriever muscular dystrophy microarray findings to novel biomarkers for cardiac/skeletal muscle function in Duchenne muscular dystrophy. 79, 629-36 (2016). WB, Dog, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 26672735

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...