Search Antibody, Protein, and ELISA Kit Solutions

BDNF Antibody - N-terminal region (ARP41969_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP41969_P050-FITC Conjugated

ARP41969_P050-HRP Conjugated

ARP41969_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Dog, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-20981 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human BDNF
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-BDNF (ARP41969_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYL
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-BDNF (ARP41969_P050) antibody is Catalog # AAP41969
Datasheets/Manuals:
Printable datasheet for anti-BDNF (ARP41969_P050) antibody
Publications:

Galindo, CL; Soslow, JH; Brinkmeyer-Langford, CL; Gupte, M; Smith, HM; Sengsayadeth, S; Sawyer, DB; Benson, DW; Kornegay, JN; Markham, LW; Translating golden retriever muscular dystrophy microarray findings to novel biomarkers for cardiac/skeletal muscle function in Duchenne muscular dystrophy. 79, 629-36 (2016). WB, Dog, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 26672735

Gene Symbol:
BDNF
Official Gene Full Name:
brain-derived neurotrophic factor
NCBI Gene Id:
627
Protein Name:
Brain-derived neurotrophic factor
Description of Target:
The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene.
Swissprot Id:
P23560-4
Protein Size (# AA):
329
Molecular Weight:
36kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BDNF.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BDNF.
Protein Interactions:
UBC; AGO3; INPP5K; F11R; JUNB; APP; ELAVL1; Ntrk2; CADPS2; MBTPS1; SORT1; NOS3; NTF4; NTF3; ESR1; NCAM1; CPE; BDNF;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...