Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP41969_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41969_P050-FITC Conjugated

ARP41969_P050-HRP Conjugated

ARP41969_P050-Biotin Conjugated

BDNF Antibody - N-terminal region (ARP41969_P050)

Catalog#: ARP41969_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-20981 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human BDNF
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-BDNF (ARP41969_P050)
Peptide Sequence Synthetic peptide located within the following region: EELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-BDNF (ARP41969_P050) antibody is Catalog # AAP41969
Datasheets/Manuals Printable datasheet for anti-BDNF (ARP41969_P050) antibody
Publications

Galindo, CL; Soslow, JH; Brinkmeyer-Langford, CL; Gupte, M; Smith, HM; Sengsayadeth, S; Sawyer, DB; Benson, DW; Kornegay, JN; Markham, LW; Translating golden retriever muscular dystrophy microarray findings to novel biomarkers for cardiac/skeletal muscle function in Duchenne muscular dystrophy. 79, 629-36 (2016). WB, Dog, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 26672735

Gene Symbol BDNF
Official Gene Full Name brain-derived neurotrophic factor
NCBI Gene Id 627
Protein Name Brain-derived neurotrophic factor
Description of Target The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene.
Swissprot Id P23560-4
Protein Size (# AA) 329
Molecular Weight 36kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express BDNF.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express BDNF.
Protein Interactions UBC; AGO3; INPP5K; F11R; JUNB; APP; ELAVL1; Ntrk2; CADPS2; MBTPS1; SORT1; NOS3; NTF4; NTF3; ESR1; NCAM1; CPE; BDNF;
  1. What is the species homology for "BDNF Antibody - N-terminal region (ARP41969_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Dog, Human, Mouse, Pig, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "BDNF Antibody - N-terminal region (ARP41969_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "BDNF Antibody - N-terminal region (ARP41969_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BDNF Antibody - N-terminal region (ARP41969_P050)"?

    This target may also be called "" in publications.

  5. What is the shipping cost for "BDNF Antibody - N-terminal region (ARP41969_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BDNF Antibody - N-terminal region (ARP41969_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BDNF Antibody - N-terminal region (ARP41969_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "36kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BDNF Antibody - N-terminal region (ARP41969_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "BDNF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BDNF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BDNF"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BDNF"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BDNF"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BDNF"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BDNF Antibody - N-terminal region (ARP41969_P050)
Your Rating
We found other products you might like!