Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41970_P050-FITC Conjugated

ARP41970_P050-HRP Conjugated

ARP41970_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human, Mouse, Monkey
Predicted Species Reactivity Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-20981 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human BDNF
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-BDNF (ARP41970_P050)
Peptide Sequence Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-BDNF (ARP41970_P050) antibody is Catalog # AAP41970 (Previous Catalog # AAPS11111)
Datasheets/Manuals Printable datasheet for anti-BDNF (ARP41970_P050) antibody
Target Reference Hashimoto,R., (2008) Neurosci. Res. 61 (4), 360-367

Horibe, I. et al. Induction of melanogenesis by 4’-O-methylated flavonoids in B16F10 melanoma cells. J. Nat. Med. 67, 705-10 (2013). IHC, WB, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 23242310

Kasemeier-Kulesa, JC; Morrison, JA; Lefcort, F; Kulesa, PM; TrkB/BDNF signalling patterns the sympathetic nervous system. 6, 8281 (2015). IHC, WB, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 26404565

Kight, KE; McCarthy, MM; Sex differences and estrogen regulation of BDNF gene expression, but not propeptide content, in the developing hippocampus. 95, 345-354 (2017). IHC, WB, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 27870444

McCarthy, D. M. et al. Cocaine alters BDNF expression and neuronal migration in the embryonic mouse forebrain. J. Neurosci. 31, 13400-11 (2011). IHC, WB, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 21940433

McCarthy, DM; Bell, GA; Cannon, EN; Mueller, KA; Huizenga, MN; Sadri-Vakili, G; Fadool, DA; Bhide, PG; Reversal Learning Deficits Associated with Increased Frontal Cortical Brain-Derived Neurotrophic Factor Tyrosine Kinase B Signaling in a Prenatal Cocaine Exposure Mouse Model. 38, 354-364 (2016). IHC, WB, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 27951531

McCarthy, DM; Mueller, KA; Cannon, EN; Huizenga, MN; Darnell, SB; Bhide, PG; Sadri-Vakili, G; Prenatal Cocaine Exposure Alters BDNF-TrkB Signaling in the Embryonic and Adult Brain. 38, 365-374 (2016). IHC, WB, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 28132054

Gene Symbol BDNF
Official Gene Full Name Brain-derived neurotrophic factor
Alias Symbols MGC34632
NCBI Gene Id 627
Protein Name Brain-derived neurotrophic factor
Description of Target BDNF is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression BDNF is reduced in both Alzheimer's and Huntington disease patients. BDNF may play a role in the regulation of stress response and in the biology of mood disorders.The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene, but the full-length nature of only some could be determined.
Swissprot Id P23560
Protein Accession # NP_001700
Nucleotide Accession # NM_001709
Protein Size (# AA) 247
Molecular Weight 27kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express BDNF.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express BDNF.
Protein Interactions UBC; AGO3; INPP5K; F11R; JUNB; APP; ELAVL1; Ntrk2; CADPS2; MBTPS1; SORT1; NOS3; NTF4; NTF3; ESR1; NCAM1; CPE; BDNF;
  1. What is the species homology for "BDNF Antibody - middle region (ARP41970_P050)"?

    The tested species reactivity for this item is "Human, Mouse, Monkey". This antibody is predicted to have homology to "Dog, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "BDNF Antibody - middle region (ARP41970_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "BDNF Antibody - middle region (ARP41970_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "BDNF Antibody - middle region (ARP41970_P050)"?

    This target may also be called "MGC34632" in publications.

  5. What is the shipping cost for "BDNF Antibody - middle region (ARP41970_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BDNF Antibody - middle region (ARP41970_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BDNF Antibody - middle region (ARP41970_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "27kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BDNF Antibody - middle region (ARP41970_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "BDNF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BDNF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BDNF"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BDNF"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BDNF"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BDNF"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BDNF Antibody - middle region (ARP41970_P050)
Your Rating