SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP41970_P050
Price: $0.00
SKU
ARP41970_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

BDNF Antibody - middle region (ARP41970_P050)

Datasheets/ManualsPrintable datasheet for anti-BDNF (ARP41970_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse, Monkey
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human BDNF
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG
Concentration0.5 mg/ml
Blocking PeptideFor anti-BDNF (ARP41970_P050) antibody is Catalog # AAP41970 (Previous Catalog # AAPS11111)
Enhanced Validation
WBY
SPR
YCHAROS
ReferenceHashimoto,R., (2008) Neurosci. Res. 61 (4), 360-367
Publications

Horibe, I. et al. Induction of melanogenesis by 4’-O-methylated flavonoids in B16F10 melanoma cells. J. Nat. Med. 67, 705-10 (2013). 23242310

McCarthy, D. M. et al. Cocaine alters BDNF expression and neuronal migration in the embryonic mouse forebrain. J. Neurosci. 31, 13400-11 (2011). 21940433

Prenatal Cocaine Exposure Alters BDNF-TrkB Signaling in the Embryonic and Adult Brain. Dev. Neurosci. 38, 365-374 (2016). 28132054

Reversal Learning Deficits Associated with Increased Frontal Cortical Brain-Derived Neurotrophic Factor Tyrosine Kinase B Signaling in a Prenatal Cocaine Exposure Mouse Model. Dev. Neurosci. 38, 354-364 (2016). 27951531

Sex differences and estrogen regulation of BDNF gene expression, but not propeptide content, in the developing hippocampus. J. Neurosci. Res. 95, 345-354 (2017). 27870444

The Bdnf and Npas4 genes are targets of HDAC3-mediated transcriptional repression. BMC Neurosci. 20, 65 (2019). 31883511

TrkB/BDNF signalling patterns the sympathetic nervous system. Nat Commun. 6, 8281 (2015). 26404565

Gene SymbolBDNF
Gene Full NameBrain-derived neurotrophic factor
Alias SymbolsANON2, BULN2
NCBI Gene Id627
Protein NameBrain-derived neurotrophic factor
Description of TargetBDNF is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression BDNF is reduced in both Alzheimer's and Huntington disease patients. BDNF may play a role in the regulation of stress response and in the biology of mood disorders.The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene, but the full-length nature of only some could be determined.
Uniprot IDP23560
Protein Accession #NP_001700
Nucleotide Accession #NM_001709
Protein Size (# AA)247
Molecular Weight28 kDa
Protein InteractionsUBC; AGO3; INPP5K; F11R; JUNB; APP; ELAVL1; Ntrk2; CADPS2; MBTPS1; SORT1; NOS3; NTF4; NTF3; ESR1; NCAM1; CPE; BDNF
  1. What is the species homology for "BDNF Antibody - middle region (ARP41970_P050)"?

    The tested species reactivity for this item is "Human, Mouse, Monkey". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "BDNF Antibody - middle region (ARP41970_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "BDNF Antibody - middle region (ARP41970_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BDNF Antibody - middle region (ARP41970_P050)"?

    This target may also be called "ANON2, BULN2" in publications.

  5. What is the shipping cost for "BDNF Antibody - middle region (ARP41970_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BDNF Antibody - middle region (ARP41970_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BDNF Antibody - middle region (ARP41970_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "28 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BDNF Antibody - middle region (ARP41970_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "BDNF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BDNF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BDNF"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BDNF"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BDNF"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BDNF"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BDNF Antibody - middle region (ARP41970_P050)
Your Rating
We found other products you might like!