Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP45118_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP45118_P050-FITC Conjugated

ARP45118_P050-HRP Conjugated

ARP45118_P050-Biotin Conjugated

B4GALNT1 Antibody - middle region (ARP45118_P050)

Catalog#: ARP45118_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-105401 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human B4GALNT1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 92%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-B4GALNT1 (ARP45118_P050)
Peptide Sequence Synthetic peptide located within the following region: GLGSLRVGSCSDVVVDHASKLKLPWTSRDAGAETYARYRYPGSLDESQMA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-B4GALNT1 (ARP45118_P050) antibody is Catalog # AAP45118 (Previous Catalog # AAPP26109)
Datasheets/Manuals Printable datasheet for anti-B4GALNT1 (ARP45118_P050) antibody
Publications

Trilck, M; Peter, F; Zheng, C; Frank, M; Dobrenis, K; Mascher, H; Rolfs, A; Frech, MJ; Diversity of glycosphingolipid GM2 and cholesterol accumulation in NPC1 patient-specific iPSC-derived neurons.. 1657, 52-61 (2017). WB, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat 27923633

Gene Symbol B4GALNT1
Official Gene Full Name Beta-1,4-N-acetyl-galactosaminyl transferase 1
Alias Symbols GALGT, GALNACT
NCBI Gene Id 2583
Protein Name Beta-1,4 N-acetylgalactosaminyltransferase 1
Description of Target GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. B4GALNT1(GalNAc-T) catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively.
Swissprot Id Q00973
Protein Accession # NP_001469
Nucleotide Accession # NM_001478
Protein Size (# AA) 533
Molecular Weight 59kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express B4GALNT1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express B4GALNT1.
Protein Interactions UBC; B4GALNT1;
Write Your Own Review
You're reviewing:B4GALNT1 Antibody - middle region (ARP45118_P050)
Your Rating