Search Antibody, Protein, and ELISA Kit Solutions

B4GALNT1 Antibody - middle region (ARP45118_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45118_P050-FITC Conjugated

ARP45118_P050-HRP Conjugated

ARP45118_P050-Biotin Conjugated

Gene Symbol:
B4GALNT1
Official Gene Full Name:
Beta-1,4-N-acetyl-galactosaminyl transferase 1
NCBI Gene Id:
2583
Protein Name:
Beta-1,4 N-acetylgalactosaminyltransferase 1
Swissprot Id:
Q00973
Protein Accession #:
NP_001469
Nucleotide Accession #:
NM_001478
Alias Symbols:
GALGT, GALNACT
Replacement Item:
This antibody may replace item sc-105401 from Santa Cruz Biotechnology.
Description of Target:
GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. B4GALNT1(GalNAc-T) catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively.
Protein Size (# AA):
533
Molecular Weight:
59kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express B4GALNT1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express B4GALNT1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human B4GALNT1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-B4GALNT1 (ARP45118_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GLGSLRVGSCSDVVVDHASKLKLPWTSRDAGAETYARYRYPGSLDESQMA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; B4GALNT1;
Blocking Peptide:
For anti-B4GALNT1 (ARP45118_P050) antibody is Catalog # AAP45118 (Previous Catalog # AAPP26109)
Datasheets/Manuals:
Printable datasheet for anti-B4GALNT1 (ARP45118_P050) antibody
Publications:

Trilck, M; Peter, F; Zheng, C; Frank, M; Dobrenis, K; Mascher, H; Rolfs, A; Frech, MJ; Diversity of glycosphingolipid GM2 and cholesterol accumulation in NPC1 patient-specific iPSC-derived neurons.. 1657, 52-61 (2017). WB, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat 27923633

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...