ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: ARP45116_P050
Price: $0.00
SKU
ARP45116_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-B4GALNT1 (ARP45116_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human B4GALNT1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: APWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGG
Concentration0.5 mg/ml
Blocking PeptideFor anti-B4GALNT1 (ARP45116_P050) antibody is Catalog # AAP45116 (Previous Catalog # AAPP26107)
ReferenceGornati,R., Mol. Cell. Biochem. 298 (1-2), 59-68 (2007)
Gene SymbolB4GALNT1
Gene Full NameBeta-1,4-N-acetyl-galactosaminyl transferase 1
Alias SymbolsGALGT, SPG26, GALNACT, GalNAc-T
NCBI Gene Id2583
Protein NameBeta-1,4 N-acetylgalactosaminyltransferase 1
Description of TargetGM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. B4GALNT1(GalNAc-T) catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively.GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. GalNAc-T catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively.
Uniprot IDQ00973
Protein Accession #NP_001469
Nucleotide Accession #NM_001478
Protein Size (# AA)533
Molecular Weight59kDa
Protein InteractionsUBC; B4GALNT1;
  1. What is the species homology for "B4GALNT1 Antibody - N-terminal region (ARP45116_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit".

  2. How long will it take to receive "B4GALNT1 Antibody - N-terminal region (ARP45116_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "B4GALNT1 Antibody - N-terminal region (ARP45116_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "B4GALNT1 Antibody - N-terminal region (ARP45116_P050)"?

    This target may also be called "GALGT, SPG26, GALNACT, GalNAc-T" in publications.

  5. What is the shipping cost for "B4GALNT1 Antibody - N-terminal region (ARP45116_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "B4GALNT1 Antibody - N-terminal region (ARP45116_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "B4GALNT1 Antibody - N-terminal region (ARP45116_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "59kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "B4GALNT1 Antibody - N-terminal region (ARP45116_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "B4GALNT1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "B4GALNT1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "B4GALNT1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "B4GALNT1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "B4GALNT1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "B4GALNT1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:B4GALNT1 Antibody - N-terminal region (ARP45116_P050)
Your Rating
We found other products you might like!