Sku |
AAP45118 |
Old sku |
AAPP26109 |
Price |
$99.00 |
Name |
B4GALNT1 Peptide - middle region (AAP45118) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
B4GALNT1 |
Alias symbols |
GALGT, GALNACT |
Gene id |
2583 |
Description of target |
GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. B4GALNT1(GalNAc-T) catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively. |
Swissprot id |
Q00973 |
Protein accession num |
NP_001469 |
Nucleotide accession num |
NM_001478 |
Protein size |
533 amino acids |
Molecular weight |
59kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
GLGSLRVGSCSDVVVDHASKLKLPWTSRDAGAETYARYRYPGSLDESQMA |
Partner proteins |
B4GALNT1,B4GALNT1 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-B4GALNT1 Antibody(ARP45118_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |