ASAH1 Recombinant Protein (Mouse) (OPCA05363)

Catalog No: OPCA05363

Product Info

• Predicted Species Reactivity: Mouse|Mus musculus
• Product Format: Liquid or Lyophilized powder
• Reconstitution and Storage: -20°C or -80°C
• Concentration: Varies by lot. See vial for exact concentration.
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTM
• Protein Sequence: QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTM
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 19-141 aa
• Tag: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
• Reference: Molecular cloning and characterization of a human cDNA and gene encoding a novel acid ceramidase-like protein.Hong S.-B., Li C.-M., Rhee H.-J., Park J.-H., He X., Levy B., Yoo O.J., Schuchman E.H.Genomics 62:232-241(1999)

Target Info

• Gene Symbol: Asah1
• Gene Full Name: N-acylsphingosine amidohydrolase 1
• Alias Symbols: 2310081N20Rik;AC;ACDase;acid CDase;acid ceramidase;acylsphingosine deacylase;Asah;N-acylethanolamine hydrolase ASAH1;N-acylsphingosine amidohydrolase.
• NCBI Gene Id: 11886
• Protein Name: Acid ceramidase
• Description of Target: Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.
• Uniprot ID: Q9WV54
• Protein Accession #: NP_062708
• Nucleotide Accession #: NM_019734
• Protein Size (# AA): Recombinant
• Molecular Weight: 33.8 kDa