Catalog No: OPCA05363
Price: $0.00
SKU
OPCA05363
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for ASAH1 Recombinant Protein (Mouse) (OPCA05363) (OPCA05363) |
---|
Predicted Species Reactivity | Mouse|Mus musculus |
---|---|
Product Format | Liquid or Lyophilized powder |
Reconstitution and Storage | -20°C or -80°C |
Concentration | Varies by lot. See vial for exact concentration. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTM |
Protein Sequence | QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTM |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | E.coli |
Protein Range | 19-141 aa |
Tag | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
Reference | Molecular cloning and characterization of a human cDNA and gene encoding a novel acid ceramidase-like protein.Hong S.-B., Li C.-M., Rhee H.-J., Park J.-H., He X., Levy B., Yoo O.J., Schuchman E.H.Genomics 62:232-241(1999) |
Gene Symbol | Asah1 |
---|---|
Gene Full Name | N-acylsphingosine amidohydrolase 1 |
Alias Symbols | 2310081N20Rik;AC;ACDase;acid CDase;acid ceramidase;acylsphingosine deacylase;Asah;N-acylethanolamine hydrolase ASAH1;N-acylsphingosine amidohydrolase. |
NCBI Gene Id | 11886 |
Protein Name | Acid ceramidase |
Description of Target | Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid. |
Uniprot ID | Q9WV54 |
Protein Accession # | NP_062708 |
Nucleotide Accession # | NM_019734 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 33.8 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!