Catalog No: ARP57760_P050
Price: $0.00
SKU
ARP57760_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ASAH1 (ARP57760_P050) antibody
Product Info
Publications

Acid ceramidase is upregulated in AML and represents a novel therapeutic target. Oncotarget. 7, 83208-83222 (2016). 27825124

Quantitative proteomics analysis using 2D-PAGE to investigate the effects of cigarette smoke and aerosol of a prototypic modified risk tobacco product on the lung proteome in C57BL/6 mice. J Proteomics. 145, 237-45 (2016). 27268958

More...

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ASAH1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWY
Concentration0.5 mg/ml
Blocking PeptideFor anti-ASAH1 (ARP57760_P050) antibody is Catalog # AAP57760 (Previous Catalog # AAPP38817)
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
ReferenceKim,H.L. (2008) Genetics 178 (3), 1505-1515
Gene SymbolASAH1
Gene Full NameN-acylsphingosine amidohydrolase (acid ceramidase) 1
Alias SymbolsAC, PHP, ASAH, PHP32, ACDase, SMAPME
NCBI Gene Id427
Protein NameAcid ceramidase
Description of TargetThis gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally. The encoded protein catalyzes the synthesis and degradation of ceramide into
Uniprot IDQ13510
Protein Accession #NP_808592
Nucleotide Accession #NM_177924
Protein Size (# AA)395
Molecular Weight45 kDa
Protein InteractionsSRPK1; CAMK1D; FBXO6; UBC; PSMA3; Bub1b; TSC22D1; SETDB1; SMPD1;
  1. What is the species homology for "ASAH1 Antibody - N-terminal region (ARP57760_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "ASAH1 Antibody - N-terminal region (ARP57760_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ASAH1 Antibody - N-terminal region (ARP57760_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ASAH1 Antibody - N-terminal region (ARP57760_P050)"?

    This target may also be called "AC, PHP, ASAH, PHP32, ACDase, SMAPME" in publications.

  5. What is the shipping cost for "ASAH1 Antibody - N-terminal region (ARP57760_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ASAH1 Antibody - N-terminal region (ARP57760_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ASAH1 Antibody - N-terminal region (ARP57760_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "45 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ASAH1 Antibody - N-terminal region (ARP57760_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ASAH1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ASAH1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ASAH1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ASAH1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ASAH1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ASAH1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ASAH1 Antibody - N-terminal region (ARP57760_P050)
Your Rating
We found other products you might like!