Search Antibody, Protein, and ELISA Kit Solutions

ASAH1 Antibody - N-terminal region (ARP57760_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP57760_P050-FITC Conjugated

ARP57760_P050-HRP Conjugated

ARP57760_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
N-acylsphingosine amidohydrolase (acid ceramidase) 1
NCBI Gene Id:
Protein Name:
Acid ceramidase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
AC, ASAH, FLJ21558, FLJ22079, PHP, PHP32, ACDase
Replacement Item:
This antibody may replace item sc-105032 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally. The encoded protein catalyzes the synthesis and degradation of ceramide into
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ASAH1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ASAH1.
The immunogen is a synthetic peptide directed towards the N terminal region of human ASAH1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Complete computational species homology data:
Anti-ASAH1 (ARP57760_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ASAH1 (ARP57760_P050) antibody is Catalog # AAP57760 (Previous Catalog # AAPP38817)
Printable datasheet for anti-ASAH1 (ARP57760_P050) antibody
Target Reference:
Kim,H.L. (2008) Genetics 178 (3), 1505-1515

Elamin, A; Titz, B; Dijon, S; Merg, C; Geertz, M; Schneider, T; Martin, F; Schlage, WK; Frentzel, S; Talamo, F; Phillips, B; Veljkovic, E; Ivanov, NV; Vanscheeuwijck, P; Peitsch, MC; Hoeng, J; Quantitative proteomics analysis using 2D-PAGE to investigate the effects of cigarette smoke and aerosol of a prototypic modified risk tobacco product on the lung proteome in C57BL/6 mice. 145, 237-45 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 27268958

Tan, SF; Liu, X; Fox, TE; Barth, BM; Sharma, A; Turner, SD; Awwad, A; Dewey, A; Doi, K; Spitzer, B; Shah, MV; Morad, SA; Desai, D; Amin, S; Zhu, J; Liao, J; Yun, J; Kester, M; Claxton, DF; Wang, HG; Cabot, MC; Schuchman, EH; Levine, RL; Feith, DJ; Loughran, TP; Acid ceramidase is upregulated in AML and represents a novel therapeutic target. 7, 83208-83222 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 27825124

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...