Size:100 ul
$319.00
In stock
SKU
ARP57760_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP57760_P050-FITC Conjugated

ARP57760_P050-HRP Conjugated

ARP57760_P050-Biotin Conjugated

ASAH1 Antibody - N-terminal region (ARP57760_P050)

Catalog#: ARP57760_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-105032 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ASAH1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Complete computational species homology dataAnti-ASAH1 (ARP57760_P050)
Peptide SequenceSynthetic peptide located within the following region: MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWY
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-ASAH1 (ARP57760_P050) antibody is Catalog # AAP57760 (Previous Catalog # AAPP38817)
Datasheets/ManualsPrintable datasheet for anti-ASAH1 (ARP57760_P050) antibody
Target ReferenceKim,H.L. (2008) Genetics 178 (3), 1505-1515
Publications

Elamin, A; Titz, B; Dijon, S; Merg, C; Geertz, M; Schneider, T; Martin, F; Schlage, WK; Frentzel, S; Talamo, F; Phillips, B; Veljkovic, E; Ivanov, NV; Vanscheeuwijck, P; Peitsch, MC; Hoeng, J; Quantitative proteomics analysis using 2D-PAGE to investigate the effects of cigarette smoke and aerosol of a prototypic modified risk tobacco product on the lung proteome in C57BL/6 mice. 145, 237-45 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 27268958

Tan, SF; Liu, X; Fox, TE; Barth, BM; Sharma, A; Turner, SD; Awwad, A; Dewey, A; Doi, K; Spitzer, B; Shah, MV; Morad, SA; Desai, D; Amin, S; Zhu, J; Liao, J; Yun, J; Kester, M; Claxton, DF; Wang, HG; Cabot, MC; Schuchman, EH; Levine, RL; Feith, DJ; Loughran, TP; Acid ceramidase is upregulated in AML and represents a novel therapeutic target. 7, 83208-83222 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 27825124

Gene SymbolASAH1
Official Gene Full NameN-acylsphingosine amidohydrolase (acid ceramidase) 1
Alias SymbolsAC, ASAH, FLJ21558, FLJ22079, PHP, PHP32, ACDase
NCBI Gene Id427
Protein NameAcid ceramidase
Description of TargetThis gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally. The encoded protein catalyzes the synthesis and degradation of ceramide into
Swissprot IdQ13510
Protein Accession #NP_808592
Nucleotide Accession #NM_177924
Protein Size (# AA)395
Molecular Weight44kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express ASAH1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express ASAH1.
Protein InteractionsSRPK1; CAMK1D; FBXO6; UBC; PSMA3; Bub1b; TSC22D1; SETDB1; SMPD1;
Write Your Own Review
You're reviewing:ASAH1 Antibody - N-terminal region (ARP57760_P050)
Your Rating
Free Microscope
Aviva Tips and Tricks
Aviva Blast Tool
Aviva Tissue Tool