SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP66514_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP66514_P050-Biotin
Availability: Domestic: within 1 week delivery | International: 1 week
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ANO5 Antibody : Biotin (ARP66514_P050-Biotin)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-ANO5 (ARP66514_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the following sequence IEDGKKRFGIERLLNSNTYSSAYPLHDGQYWKPSEPPNPTNERYTLHQNW
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 92%; Guinea Pig: 83%; Horse: 92%; Human: 100%; Pig: 92%; Rabbit: 93%; Rat: 83%
Peptide SequenceSynthetic peptide located within the following region: IEDGKKRFGIERLLNSNTYSSAYPLHDGQYWKPSEPPNPTNERYTLHQNW
Concentration0.5 mg/ml
Blocking PeptideAvailable upon request
Gene SymbolANO5
Gene Full Nameanoctamin 5
Alias SymbolsGDD1, LGMD2L, LGMDR12, TMEM16E
NCBI Gene Id203859
Protein NameAnoctamin-5
Description of TargetThis gene encodes a member of the anoctamin family of transmembrane proteins. The encoded protein is likely a calcium activated chloride channel. Mutations in this gene have been associated with gnathodiaphyseal dysplasia. Alternatively spliced transcript variants have been described.
Uniprot IDQ75V66
Protein Accession #NP_998764
Nucleotide Accession #NM_001142649
Protein Size (# AA)913
Molecular Weight107 kDa
Protein InteractionsUBC;
  1. What is the species homology for "ANO5 Antibody : Biotin (ARP66514_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "ANO5 Antibody : Biotin (ARP66514_P050-Biotin)"?

    This item is available "Domestic: within 1 week delivery | International: 1 week".

  3. What buffer format is "ANO5 Antibody : Biotin (ARP66514_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ANO5 Antibody : Biotin (ARP66514_P050-Biotin)"?

    This target may also be called "GDD1, LGMD2L, LGMDR12, TMEM16E" in publications.

  5. What is the shipping cost for "ANO5 Antibody : Biotin (ARP66514_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ANO5 Antibody : Biotin (ARP66514_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ANO5 Antibody : Biotin (ARP66514_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "107 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ANO5 Antibody : Biotin (ARP66514_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ANO5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ANO5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ANO5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ANO5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ANO5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ANO5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ANO5 Antibody : Biotin (ARP66514_P050-Biotin)
Your Rating
We found other products you might like!