ANO5 Antibody : HRP (ARP66514_P050-HRP)

Catalog No: ARP66514_P050-HRP

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence IEDGKKRFGIERLLNSNTYSSAYPLHDGQYWKPSEPPNPTNERYTLHQNW
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 92%; Guinea Pig: 83%; Horse: 92%; Human: 100%; Pig: 92%; Rabbit: 93%; Rat: 83%
• Peptide Sequence: Synthetic peptide located within the following region: IEDGKKRFGIERLLNSNTYSSAYPLHDGQYWKPSEPPNPTNERYTLHQNW
• Concentration: 0.5 mg/ml
• Blocking Peptide: Available upon request

Target Info

• Gene Symbol: ANO5
• Gene Full Name: anoctamin 5
• Alias Symbols: GDD1, LGMD2L, LGMDR12, TMEM16E
• NCBI Gene Id: 203859
• Protein Name: Anoctamin-5
• Description of Target: This gene encodes a member of the anoctamin family of transmembrane proteins. The encoded protein is likely a calcium activated chloride channel. Mutations in this gene have been associated with gnathodiaphyseal dysplasia. Alternatively spliced transcript variants have been described.
• Uniprot ID: Q75V66
• Protein Accession #: NP_998764
• Nucleotide Accession #: NM_001142649
• Protein Size (# AA): 913
• Molecular Weight: 107 kDa
• Protein Interactions: UBC;