Search Antibody, Protein, and ELISA Kit Solutions

ANO5 Antibody - N-terminal region (ARP66514_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP66514_P050-FITC Conjugated

ARP66514_P050-HRP Conjugated

ARP66514_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
anoctamin 5
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
This gene encodes a member of the anoctamin family of transmembrane proteins. The encoded protein is likely a calcium activated chloride channel. Mutations in this gene have been associated with gnathodiaphyseal dysplasia. Alternatively spliced transcript variants have been described.
Protein Size (# AA):
Molecular Weight:
107 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ANO5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ANO5.
The immunogen is a synthetic peptide directed towards the N terminal region of human ANO5
Predicted Homology Based on Immunogen Sequence:
Dog: 92%; Guinea Pig: 83%; Horse: 92%; Human: 100%; Pig: 92%; Rabbit: 93%; Rat: 83%
Peptide Sequence:
Synthetic peptide located within the following region: PLHDGQYWKPSEPPNPTNERYTLHQNWARFSYFYKEQPLDLIKNYYGEKI
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ANO5 (ARP66514_P050) antibody is Catalog # AAP66514
Printable datasheet for anti-ANO5 (ARP66514_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...