ALS2 Antibody - middle region (ARP57487_P050)

Catalog No: ARP57487_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-ALS2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ALS2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: ALRGMSDLPPYGSGSSVQRQEPPISRSAKYTFYKDPRLKDATYDGRWLSG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ALS2 (ARP57487_P050) antibody is Catalog # AAP57487 (Previous Catalog # AAPP41541)

Target Info

• Gene Symbol: ALS2
• Gene Full Name: Amyotrophic lateral sclerosis 2 (juvenile)
• Alias Symbols: ALSJ, PLSJ, IAHSP, ALS2CR6
• NCBI Gene Id: 57679
• Protein Name: Alsin
• Description of Target: The protein encoded by this gene contains an ATS1/RCC1-like domain, a RhoGEF domain, and a vacuolar protein sorting 9 (VPS9) domain, all of which are guanine-nucleotide exchange factors that activate members of the Ras superfamily of GTPases. The protein functions as a guanine nucleotide exchange factor for the small GTPase RAB5. The protein localizes with RAB5 on early endosomal compartments, and functions as a modulator for endosomal dynamics. Mutations in this gene result in several forms of juvenile lateral sclerosis and infantile-onset ascending spastic paralysis. Multiple transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: Q96Q42
• Protein Accession #: NP_065970
• Nucleotide Accession #: NM_020919
• Protein Size (# AA): 1657
• Molecular Weight: 184kDa
• Protein Interactions: VCP; UBC; YWHAB;