Search Antibody, Protein, and ELISA Kit Solutions

Zhx1 Antibody - C-terminal region (ARP32853_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32853_P050-FITC Conjugated

ARP32853_P050-HRP Conjugated

ARP32853_P050-Biotin Conjugated

Gene Symbol:
Zhx1
Official Gene Full Name:
Zinc fingers and homeoboxes 1
NCBI Gene Id:
22770
Protein Name:
Zinc fingers and homeoboxes protein 1
Swissprot Id:
P70121
Protein Accession #:
NP_033598
Nucleotide Accession #:
NM_009572
Alias Symbols:
KIAA4149, mKIAA4149, 3110006I21Rik
Replacement Item:
This antibody may replace item sc-366817 from Santa Cruz Biotechnology.
Description of Target:
Zhx1 acts as a transcriptional repressor.
Protein Size (# AA):
873
Molecular Weight:
97kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Zhx1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Zhx1.
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Horse: 93%; Human: 93%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-Zhx1 (ARP32853_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TGTAILKDYYLKHKFLNEQDLDELVNRSHMGYEQVREWFAERQRRSELGI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Zhx1 (ARP32853_P050) antibody is Catalog # AAP32853 (Previous Catalog # AAPP03873)
Datasheets/Manuals:
Printable datasheet for anti-Zhx1 (ARP32853_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...