Search Antibody, Protein, and ELISA Kit Solutions

ZHX1 Antibody - N-terminal region (ARP38924_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38924_P050-FITC Conjugated

ARP38924_P050-HRP Conjugated

ARP38924_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Zinc fingers and homeoboxes 1
NCBI Gene Id:
Protein Name:
Zinc fingers and homeoboxes protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-366817 from Santa Cruz Biotechnology.
Description of Target:
The members of the zinc fingers and homeoboxes gene family are nuclear homodimeric transcriptional repressors that interact with the A subunit of nuclear factor-Y (NF-YA) and contain two C2H2-type zinc fingers and five homeobox DNA-binding domains. This gene encodes member 1 of this gene family. In addition to forming homodimers, this protein heterodimerizes with members 2 and 3 of the zinc fingers and homeoboxes family. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the downstream chromosome 8 open reading frame 76 (C8orf76) gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZHX1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZHX1.
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 100%; Rat: 86%
Complete computational species homology data:
Anti-ZHX1 (ARP38924_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PPVLTPVENTRAESISSDEEVHESVDSDNQQNKKVEGGYECKYCTFQTPD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ZHX1 (ARP38924_P050) antibody is Catalog # AAP38924
Printable datasheet for anti-ZHX1 (ARP38924_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...