Search Antibody, Protein, and ELISA Kit Solutions

ZFR Antibody - middle region (ARP34527_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34527_P050-FITC Conjugated

ARP34527_P050-HRP Conjugated

ARP34527_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Zinc finger RNA binding protein
NCBI Gene Id:
Protein Name:
Zinc finger RNA-binding protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FLJ41312, ZFR1
Replacement Item:
This antibody may replace item sc-135326 from Santa Cruz Biotechnology.
Description of Target:
ZFR is critical for Staufen 2 isoform specific nucleocytoplasmic shuttling in neurons.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZFR.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZFR.
The immunogen is a synthetic peptide directed towards the middle region of human ZFR
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-ZFR (ARP34527_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RQIHKVLGMDPLPQMSQRFNIHNNRKRRRDSDGVDGFEAEGKKDKKDYDN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ZFR (ARP34527_P050) antibody is Catalog # AAP34527 (Previous Catalog # AAPP05709)
Printable datasheet for anti-ZFR (ARP34527_P050) antibody
Sample Type Confirmation:

ZFR is strongly supported by BioGPS gene expression data to be expressed in HT1080

Target Reference:
Andersen,J.S., (2005) Nature 433 (7021), 77-83

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...